Peptide Libraray

Shiva-1

General Information

DCTPep ID DCTPep01076

Peptide Name Shiva-1

Sequence MPRWRLFRRIDRVGKQIKQGILRAGPAIALVGDARAVG

Sequence Length 38

UniProt ID Not available

PubChem CID Not available

Origin Magainin

Type Synthetic peptide

Classification

ACP Tumor active peptide

Activity Information

Cell Line	Disease	Activity	Assay	Testing Time	Literature
K562	Blast phase chronic myelogenous leukemia, BCR-ABL1 positive; Chronic myeloid leukemia	IC50=28.7 µM	MTT assay	96 h	1
HRT-18	Colon adenocarcinoma	IC50=49.3 µM	MTT assay	96 h	1
BTS-30	Breast Cancer	IC50=56 µM	MTT assay	96 h	1
DLD-1	Colon adenocarcinoma	IC50>100 µM	MTT assay	96 h	1

Hemolytic Activity Not available

Normal (non-cancerous) Cytotoxicity Not available

Target Not available

Affinity Not available

Mechanism Not available

Structure Information

PDB ID Not available

Predicted Structure DCTPep01076

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity Not available

Linear/Cyclic Linear

Disulfide/Other Bond Not available

N-terminal Modification Free

C-terminal Modification Amidation

Other Modification None

Chiral L

Physicochemical Information

Formula C189H322N64O45S1

Absent amino acids CEHNSTY

Theoretical pI 12.13

Acidic residues 2

Basic residues 9

Polar residues 5

Molecular weight (Average) 4243.1

Molecular weight (Monoisotopic) 4240.46

Common amino acids R

Net charge 7

Instability index (II) 61.74

Aliphatic index 107.89

Grand average of hydropathicity (GRAVY) -0.097

Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).

Extinction coefficients
Ext. coefficient 5500
Abs 0.1% (=1 g/l) 1.296

Amino acid distribution

Literature Information

Literature 1

Pubmed ID 7849420

Title Preliminary experimental anticancer activity of cecropins

Doi Not available

Year 1994

Patent

Patent ID Not available

Patent Title Not available

Other Iinformation Not available

Other Published ID Not available