This work is licensed under a Creative Commons Attribution 4.0 International License.
EH-APP
General Information
DCTPep ID DCTPep01078
Peptide Name EH-APP
Sequence GEILCNLCTGLINTLENLLTTKGADKVKDYISSLCNKASGFIATLCTKVLDFGIDKLIQLIEDKVDANAICAKIHAC
Sequence Length 77
UniProt ID Not available
PubChem CID Not available
Origin Entamoeba histolytica
Type Native peptide
Classification
ACP Tumor active peptide
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| Jurkat | Childhood T acute lymphoblastic leukemia; Precursor T-cell acute lymphoblastic leukemia | LC50=14 µM | Trypan blue assay | 1h | 1 |
| U-937 | Adult acute monocytic leukemi; Acute monoblastic/monocytic leukemia | LC50=80 µM | Trypan blue assay | 1h | 1 |
Hemolytic Activity Human erythrocytes: 10% Hemolysis=10 µm
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep01078
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Cys5<--->Cys77; Cys8<--->Cys71; Cys35<--->Cys46
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C362H605N93O112S6
Absent amino acids MPRW
Theoretical pI 5.65
Acidic residues 9
Basic residues 9
Polar residues 26
Molecular weight (Average) 8244.7
Molecular weight (Monoisotopic) 8239.28
Common amino acids L
Net charge 0
Instability index (II) 24.71
Aliphatic index 121.69
Grand average of hydropathicity (GRAVY) 0.406
Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 1865
Abs 0.1% (=1 g/l) 0.226, assuming all pairs of Cys residues form cystines
Ext. coefficient 1490
Abs 0.1% (=1 g/l) 0.181, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 8146160
Title Cytolytic and antibacterial activity of synthetic peptides derived from amoebapore, the pore-forming peptide of Entamoeba histolytica
Year 1994
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.