Peptide Libraray

VKVR

General Information

DCTPep ID DCTPep01123

Peptide Name VKVR

Sequence VKDGYIVDDKNCAYFCGRNAYCDDECEKNGAESGYCQWAGVYGNACWCYKLPDKVPIRVPGRCNG

Sequence Length 65

UniProt ID G4V3T9

PubChem CID Not available

Origin Scorpion

Type Native peptide

Classification

ACP Tumor active peptide

Activity Information

Cell Line	Disease	Activity	Assay	Testing Time	Literature
Mouse S180 sarcoma	Mouse S180 sarcoma	At a dose of 4.4 mg/kg body weight, the tumor weight inhibition rate was 46%	Antitumor in vivo	7 days	Patent

Hemolytic Activity Not available

Normal (non-cancerous) Cytotoxicity Not available

Target Not available

Affinity Not available

Mechanism Not available

Structure Information

PDB ID Not available

Predicted Structure DCTPep01123

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity Not available

Linear/Cyclic Linear

Disulfide/Other Bond Not available

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Chiral L

Physicochemical Information

Formula C313H463N87O97S8

Absent amino acids HMT

Theoretical pI 5.13

Acidic residues 9

Basic residues 8

Polar residues 28

Molecular weight (Average) 7253.12

Molecular weight (Monoisotopic) 7248.17

Common amino acids CG

Net charge -1

Instability index (II) 17.05

Aliphatic index 48.00

Grand average of hydropathicity (GRAVY) -0.589

Half Life
100 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).

Extinction coefficients
Ext. coefficient 20440
Abs 0.1% (=1 g/l) 2.818, assuming all pairs of Cys residues form cystines
Ext. coefficient 19940
Abs 0.1% (=1 g/l) 2.749, assuming all Cys residues are reduced

Amino acid distribution

Literature Information

Literature 1

Pubmed ID Not available

Title Not available

Doi Not available

Year Not available

Patent

Patent ID CN102690342B

Patent Title Anti-cancer analgesic peptide VKVR, its preparation method and application

Other Iinformation Granted Patent; Family: 2s/2ex; Family Jurisdictions: CN; Legal Status: Active; Application No: 201110069002; Filed: Mar 22, 2011; Published: Oct 29, 2014; Earliest Priority: Mar 22, 2011; Granted: Oct 29, 2014

Other Published ID CN102690342B