This work is licensed under a Creative Commons Attribution 4.0 International License.
CB1a, Cecropin-B1a
General Information
DCTPep ID DCTPep01139
Peptide Name CB1a, Cecropin-B1a
Sequence KWKVFKKIEKKWKVFKKIEKAGPKWKVFKKIEK
Sequence Length 33
UniProt ID P01508
PubChem CID Not available
Origin Not available
Type Synthetic peptide
Classification
ACP Tumor active peptide
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| NCI-H520 | Lung squamous cell carcinoma | IC50=22.7±0.2 µM | MTT assay | 48 h | 1 |
| NCI-H661 | Lung squamous cell carcinoma | IC50=35.9±0.2 µM | MTT assay | 48 h | 1 |
| CCRF-CEM | Childhood T acute lymphoblastic leukemia; Precursor T-cell acute lymphoblastic leukemia | IC50=4.4±0.3 µM | MTT assay | 48 h | 1 |
| AGS | Gastric adenocarcinoma | IC50=5.6±0.5 µM | MTT assay | 48 h | 1 |
| HL-60 | Adult acute myeloid leukemia; Acute myeloid leukemia | IC50=6.7±1.1 µM | MTT assay | 48 h | 1 |
Hemolytic Activity Human erythrocytes: 18% Hemolysis=200 µM
Normal (non-cancerous) Cytotoxicity RPMI-7666: IC50>100 µM; NIH 3T3: IC50>50 µM; WI-38: IC50>100 µM
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID 2IGR
Predicted Structure DCTPep01139
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Amidation
Other Modification None
Chiral L
Physicochemical Information
Formula C208H335N51O40
Absent amino acids CDHLMNQRSTY
Theoretical pI 10.44
Acidic residues 3
Basic residues 15
Polar residues 1
Molecular weight (Average) 4190.27
Molecular weight (Monoisotopic) 4187.57
Common amino acids K
Net charge 12
Instability index (II) 20.54
Aliphatic index 64.85
Grand average of hydropathicity (GRAVY) -1.133
Half Life
1.3 hours (mammalian reticulocytes, in vitro).
3 min (yeast, in vivo).
3 min (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 16500
Abs 0.1% (=1 g/l) 3.938
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 19428759
Title Structure and function of a custom anticancer peptide, CB1a
Doi 10.1016/j.peptides.2009.02.004
Year 2009
Patent
Patent ID CN108546285A
Patent Title Anticancer biological active peptide CB1a and applications thereof
Other Iinformation Patent Application; Family: 2s / 2ex; Family Jurisdictions: CN; Legal Status: Active; Application No: 201810184631; Filed: Mar 7, 2018; Published: Sep 18, 2018; Earliest Priority: Mar 7, 2018; Granted: Oct 26, 2021
Other Published ID CN108546285B
This work is licensed under a Creative Commons Attribution 4.0 International License.