Peptide Libraray

ALT614

General Information

DCTPep ID DCTPep01140

Peptide Name ALT614

Sequence MADIKQEHDTELDQNYSLGSNTDPKNMQELTQYVQTLLQSVQDKFQTMSDQILNRIDEMGSRIDDLEKNISDLMTQAGVEGPDK

Sequence Length 84

UniProt ID Not available

PubChem CID Not available

Origin Antlion

Type Native peptide

Classification

ACP Tumor active peptide

Activity Information

Cell Line	Disease	Activity	Assay	Testing Time	Literature
MKN45	Gastric adenocarcinoma	IC50=40.65 μg/ml	MTT assay	24 h	Patent
SGC-7901	Human papillomavirus-related endocervical adenocarcinoma	IC50=45.06 μg/ml	MTT assay	24 h	Patent
BGC-823	Human papillomavirus-related endocervical adenocarcinoma	IC50=49.45 μg/ml	MTT assay	24 h	Patent
AGS	Gastric adenocarcinoma	IC50=50.37 μg/ml	MTT assay	24 h	Patent
MKN28	Gastric tubular adenocarcinoma	IC50=52.51 μg/ml	MTT assay	24 h	Patent
KATO III	Down syndrome; Gastric signet ring cell adenocarcinoma	IC50=57.52 μg/ml	MTT assay	24 h	Patent
MGC-803	Gastric mucinous adenocarcinoma	IC50=58.33 μg/ml	MTT assay	24 h	Patent

Hemolytic Activity Not available

Normal (non-cancerous) Cytotoxicity Not available

Target Not available

Affinity Not available

Mechanism Not available

Structure Information

PDB ID Not available

Predicted Structure DCTPep01140

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity Not available

Linear/Cyclic Linear

Disulfide/Other Bond Not available

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Chiral L

Physicochemical Information

Formula C403H650N112O148S5

Absent amino acids CW

Theoretical pI 4.16

Acidic residues 17

Basic residues 8

Polar residues 23

Molecular weight (Average) 9592.56

Molecular weight (Monoisotopic) 9586.54

Common amino acids DQ

Net charge -9

Instability index (II) 34.93

Aliphatic index 73.10

Grand average of hydropathicity (GRAVY) -0.937

Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).

Extinction coefficients
Ext. coefficient 2980
Abs 0.1% (=1 g/l) 0.311

Amino acid distribution

Literature Information

Literature 1

Pubmed ID Not available

Title Not available

Doi Not available

Year Not available

Patent

Patent ID CN109485711A

Patent Title Antlion micromolecular peptide and separation and purification method and application thereof

Other Iinformation Patent Application; Family: 2s / 2ex; Family Jurisdictions: CN; Legal Status: Active; Application No: 201811252747; Filed: Oct 25, 2018; Published: Mar 19, 2019; Earliest Priority: Oct 25, 2018; Granted: Jul 20, 2021

Other Published ID CN109485711B