B7
General Information
DCTPep ID DCTPep01184
Peptide Name B7
Sequence GISCAETCVLLPCLSSVIGCTCQNKRCYKN
Sequence Length 30
UniProt ID Not available
PubChem CID Not available
Origin Hedyotis biflora
Type Native peptide
Classification
ACP Tumor active peptide
Activity Information
Cell Line | Disease | Activity | Assay | Testing Time | Literature |
---|---|---|---|---|---|
MOH-1 | Pancreatic adenocarcinoma | IC50=0.33 μM | MTT assay | 72h | Patent |
PANC-1 | Pancreatic ductal adenocarcinoma | IC50=0.36 μM | MTT assay | 72h | Patent |
Capan-2 | Pancreatic ductal adenocarcinoma | IC50=0.45 μM | MTT assay | 72h | Patent |
BxPC-3 | Pancreatic ductal adenocarcinoma | IC50=0.68 μM | MTT assay | 72h | Patent |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep01184
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C132H224N38O42S6
Absent amino acids DFHMW
Theoretical pI 8.33
Acidic residues 1
Basic residues 3
Polar residues 16
Molecular weight (Average) 3207.82
Molecular weight (Monoisotopic) 3205.49
Common amino acids C
Net charge 2
Instability index (II) 59.05
Aliphatic index 87.67
Grand average of hydropathicity (GRAVY) 0.393
Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 1865
Abs 0.1% (=1 g/l) 0.581, assuming all pairs of Cys residues form cystines
Ext. coefficient 1490
Abs 0.1% (=1 g/l) 0.464, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID Not available
Title Novel cyclotides from Hedyotis biflora inhibit proliferation and migration of pancreatic cancer cell in vitro and in vivo
Year 2013
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available