This work is licensed under a Creative Commons Attribution 4.0 International License.
Sequence 6 from Patent US 20020137896
General Information
DCTPep ID DCTPep01216
Peptide Name Sequence 6 from Patent US 20020137896
Sequence FVNIINGALQPISISPSDTYQPTLAVAAWAPPIDPAEGQLVIMGHNPNQEAGLNLPGSAVT
Sequence Length 61
UniProt ID Q8J2V8
PubChem CID Not available
Origin Synthetic construct
Type Native peptide
Classification
ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep01216
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Not available
C-terminal Modification Not available
Other Modification None
Chiral L
Physicochemical Information
Formula C282H441N73O87S1
Absent amino acids CKR
Theoretical pI 3.91
Acidic residues 4
Basic residues 1
Polar residues 18
Molecular weight (Average) 6278.1
Molecular weight (Monoisotopic) 6274.2
Common amino acids AP
Net charge -3
Instability index (II) 46.84
Aliphatic index 102.46
Grand average of hydropathicity (GRAVY) 0.179
Half Life
1.1 hours (mammalian reticulocytes, in vitro).
3 min (yeast, in vivo).
2 min (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 6990
Abs 0.1% (=1 g/l) 1.113
Amino acid distribution
Literature Information
Literature 1
Pubmed ID Not available
Title Not available
Doi Not available
Year Not available
Patent
Patent ID US 2002/0137896 A1
Patent Title Antitumor protein and gene encoding same.
Other Iinformation Granted Patent Family: 3s / 5ex; Family Jurisdictions: US; Legal Status: Expired; Application No: 91196901; Filed:Jul 24, 2001; Published: Sep 26, 2002; Earliest Priority: Feb 13, 1997; Granted: Jul 13, 2004
This work is licensed under a Creative Commons Attribution 4.0 International License.