This work is licensed under a Creative Commons Attribution 4.0 International License.
Sequence 4 from Patent US 20020137896
General Information
DCTPep ID DCTPep01223
Peptide Name Sequence 4 from Patent US 20020137896
Sequence PIRLSKEKINDLLQRSQGDLTSSQHEIVHFTDVFIAGSGPISCTYARHIIDNTSTTK
Sequence Length 57
UniProt ID Not available
PubChem CID Not available
Origin Synthetic construct
Type Native peptide
Classification
ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep01223
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Not available
C-terminal Modification Not available
Other Modification None
Chiral L
Physicochemical Information
Formula C276H446N80O89S1
Absent amino acids MW
Theoretical pI 7.36
Acidic residues 6
Basic residues 9
Polar residues 20
Molecular weight (Average) 6341.12
Molecular weight (Monoisotopic) 6337.26
Common amino acids IST
Net charge 3
Instability index (II) 57.16
Aliphatic index 88.95
Grand average of hydropathicity (GRAVY) -0.386
Half Life
>20 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
? (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 1490
Abs 0.1% (=1 g/l) 0.235, assuming all pairs of Cys residues form cystines
Ext. coefficient 1490
Abs 0.1% (=1 g/l) 0.235, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID Not available
Title Not available
Doi Not available
Year Not available
Patent
Patent ID US 2002/0137896 A1
Patent Title Antitumor protein and gene encoding same.
Other Iinformation Granted Patent Family: 3s / 5ex; Family Jurisdictions: US; Legal Status: Expired; Application No: 91196901; Filed:Jul 24, 2001; Published: Sep 26, 2002; Earliest Priority: Feb 13, 1997; Granted: Jul 13, 2004
This work is licensed under a Creative Commons Attribution 4.0 International License.