Sequence 8 from Patent US 20020137896

General Information


DCTPep ID  DCTPep01224

Peptide Name   Sequence 8 from Patent US 20020137896

Sequence  QEFDALLERAKTLLNVHSDQYDDSIRQIVVK

Sequence Length  31

UniProt ID  Q8J2V8 

PubChem CID  Not available

Origin  Synthetic construct

Type  Native peptide

Classification

  

ACP



Activity Information


Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available



Structure Information


PDB ID  Not available

Predicted Structure  DCTPep01224

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Not available

N-terminal Modification  Not available

C-terminal Modification  Not available

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C160H259N45O52

Absent amino acids  CGMPW

Theoretical pI  4.89

Acidic residues  6

Basic residues  5

Polar residues  5

Molecular weight (Average)  3645.09

Molecular weight (Monoisotopic)  3642.9

Common amino acids  DL

Net charge  -1

Instability index (II)  33.84

Aliphatic index  110.00

Grand average of hydropathicity (GRAVY)  -0.497

Half Life 
  0.8 hours (mammalian reticulocytes, in vitro).
  10 min (yeast, in vivo).
  10 hours (Escherichia coli, in vivo).

Extinction coefficients 
  Ext. coefficient 1490
  Abs 0.1% (=1 g/l) 0.409

Amino acid distribution



Literature Information


Literature 1

Pubmed ID Not available

Title  Not available

Doi Not available

Year  Not available

Patent

Patent ID US 2002/0137896 A1

Patent Title  Antitumor protein and gene encoding same.

Other Iinformation  Granted Patent Family: 3s / 5ex; Family Jurisdictions: US; Legal Status: Expired; Application No: 91196901; Filed:Jul 24, 2001; Published: Sep 26, 2002; Earliest Priority: Feb 13, 1997; Granted: Jul 13, 2004

Other Published ID  US6291648  US6762296 




DCTPep is developed by Dr.Zheng's team.