DCTPep ID  DCTPep01226

Peptide Name   Sequence 11 from Patent US 20020137896

Sequence  SFVIACGAVCTPQILWNSNIRPYALGRYLSEQSMTFCQIVLKRGIVDAIATDPRFAAK

Sequence Length  58

UniProt ID  Not available

PubChem CID  Not available

Origin  Synthetic construct

Type  Native peptide

Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available

PDB ID  Not available

Predicted Structure  DCTPep01226

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Not available

N-terminal Modification  Not available

C-terminal Modification  Not available

Other Modification  None

Chiral  L

Grand average of hydropathicity (GRAVY)  0.359

Half Life 
  1.9 hours (mammalian reticulocytes, in vitro).
  >20 hours (yeast, in vivo).
  >10 hours (Escherichia coli, in vivo).

Extinction coefficients 
  Ext. coefficient 8605
  Abs 0.1% (=1 g/l) 1.343, assuming all pairs of Cys residues form cystines
  Ext. coefficient 8480
  Abs 0.1% (=1 g/l) 1.324, assuming all Cys residues are reduced

Amino acid distribution

Literature 1

Pubmed ID Not available

Title  Not available

Doi Not available

Year  Not available

Patent

Patent ID US 2002/0137896 A1

Patent Title  Antitumor protein and gene encoding same.

Other Iinformation  Granted Patent Family: 3s / 5ex; Family Jurisdictions: US; Legal Status: Expired; Application No: 91196901; Filed:Jul 24, 2001; Published: Sep 26, 2002; Earliest Priority: Feb 13, 1997; Granted: Jul 13, 2004

Other Published ID  US6291648  US6762296