Sequence 16 from Patent US 20020137896

General Information


DCTPep ID  DCTPep01228

Peptide Name   Sequence 16 from Patent US 20020137896

Sequence  VHNFNNLWVGGNGCIPDATACNPTRTSVAYALK

Sequence Length  33

UniProt ID  Not available

PubChem CID  Not available

Origin  Synthetic construct

Type  Native peptide

Classification

  

ACP



Activity Information


Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available



Structure Information


PDB ID  Not available

Predicted Structure  DCTPep01228

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Not available

N-terminal Modification  Not available

C-terminal Modification  Not available

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C153H235N45O46S2

Absent amino acids  EMQ

Theoretical pI  8.03

Acidic residues  1

Basic residues  3

Polar residues  15

Molecular weight (Average)  3504.94

Molecular weight (Monoisotopic)  3502.69

Common amino acids  N

Net charge  2

Instability index (II)  24.85

Aliphatic index  73.94

Grand average of hydropathicity (GRAVY)  -0.073

Half Life 
  100 hours (mammalian reticulocytes, in vitro).
  >20 hours (yeast, in vivo).
  >10 hours (Escherichia coli, in vivo).

Extinction coefficients 
  Ext. coefficient 7115
  Abs 0.1% (=1 g/l) 2.030, assuming all pairs of Cys residues form cystines
  Ext. coefficient 6990
  Abs 0.1% (=1 g/l) 1.994, assuming all Cys residues are reduced

Amino acid distribution



Literature Information


Literature 1

Pubmed ID Not available

Title  Not available

Doi Not available

Year  Not available

Patent

Patent ID US 2002/0137896 A1

Patent Title  Antitumor protein and gene encoding same.

Other Iinformation  Granted Patent Family: 3s / 5ex; Family Jurisdictions: US; Legal Status: Expired; Application No: 91196901; Filed:Jul 24, 2001; Published: Sep 26, 2002; Earliest Priority: Feb 13, 1997; Granted: Jul 13, 2004

Other Published ID  US6291648  US6762296 




DCTPep is developed by Dr.Zheng's team.