DCTPep ID  DCTPep01235

Peptide Name   Sequence 14 from Patent US 20030077289

Sequence  KKKKKKGGFLGFWRGENGRKTRSAYERMCNILKGK

Sequence Length  35

UniProt ID  Not available

PubChem CID  Not available

Origin  Synthetic construct

Type  Synthetic peptide

Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available

PDB ID  Not available

Predicted Structure  DCTPep01235

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity  Not available

Linear/Cyclic  Not available

Disulfide/Other Bond  Not available

N-terminal Modification  Not available

C-terminal Modification  Not available

Other Modification  None

Chiral  L

Grand average of hydropathicity (GRAVY)  -1.409

Half Life 
  1.3 hours (mammalian reticulocytes, in vitro).
  3 min (yeast, in vivo).
  3 min (Escherichia coli, in vivo).

Extinction coefficients 
  Ext. coefficient 6990
  Abs 0.1% (=1 g/l) 1.704, assuming all pairs of Cys residues form cystines
  Ext. coefficient 6990
  Abs 0.1% (=1 g/l) 1.704, assuming all Cys residues are reduced

Amino acid distribution

Literature 1

Pubmed ID Not available

Title  Not available

Doi Not available

Year  Not available

Patent

Patent ID US 2003/0077289 A1

Patent Title  Use of cell-penetrating peptides to generate antitumor immunity.

Other Iinformation  Granted Patent Family: 6s / 6ex; Family Jurisdictions: CN, WO, AU, US; Legal Status: Discontinued; Application No: 7755502; Filed:Feb 15, 2002; Published: Apr 24, 2003; Earliest Priority: Feb 15, 2001

Other Published ID  CN1309417C  CN1503628A  WO2002064057A2  WO2002064057A3