DCTPep ID  DCTPep01289

Peptide Name   Sequence 3 from Patent US 20060252676

Sequence  MGSSHHHHHHSSGLVPGSHMVRDGYIADDKNCAYFCGRNAYCDDECKKNGAESGYCQWAGVYGNACWCYKLPDKVPIRVPGKCNGG

Sequence Length  86

UniProt ID  Not available

PubChem CID  Not available

Origin  Scorpion

Type  Native peptide

Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available

PDB ID  Not available

Predicted Structure  DCTPep01289

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity  Not available

Linear/Cyclic  Not available

Disulfide/Other Bond  Not available

N-terminal Modification  Not available

C-terminal Modification  Not available

Other Modification  None

Chiral  L

Grand average of hydropathicity (GRAVY)  -0.685

Half Life 
  30 hours (mammalian reticulocytes, in vitro).
  >20 hours (yeast, in vivo).
  >10 hours (Escherichia coli, in vivo).

Extinction coefficients 
  Ext. coefficient 20440
  Abs 0.1% (=1 g/l) 2.170, assuming all pairs of Cys residues form cystines
  Ext. coefficient 19940
  Abs 0.1% (=1 g/l) 2.117, assuming all Cys residues are reduced

Amino acid distribution

Literature 1

Pubmed ID Not available

Title  Not available

Doi Not available

Year  Not available

Patent

Patent ID US 2006/0252676 A1

Patent Title  Analgesic antitumor peptide from scorpion and method of producing it.

Other Iinformation  Granted Patent Family: 10s / 10ex; Family Jurisdictions: US, DE, AT, CN, EP, WO; Legal Status: Active; Application No: 49107704; Filed:Dec 13, 2004; Published: Nov 9, 2006; Earliest Priority: Sep 30, 2001; Granted: Sep 22, 2009

Other Published ID  CN1325514C  CN1341662A  DE60233064D1  EP1443053A1  EP1443053A4  EP1443053B1  US7592309  WO2003037922A1