This work is licensed under a Creative Commons Attribution 4.0 International License.
Sequence 1 from Patent US 20060252676
General Information
DCTPep ID DCTPep01291
Peptide Name Sequence 1 from Patent US 20060252676
Sequence VRDGYIADDKNCAYFCGRNAYCDDECKKNGAESGYCQWAGVYGNACWCYKLPDKVPIRVPGKCNGG
Sequence Length 66
PubChem CID Not available
Origin Scorpion
Type Native peptide
Classification
ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep01291
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Not available
Disulfide/Other Bond Not available
N-terminal Modification Not available
C-terminal Modification Not available
Other Modification None
Chiral L
Physicochemical Information
Formula C314H467N89O96S8
Absent amino acids HMT
Theoretical pI 7.64
Acidic residues 8
Basic residues 9
Polar residues 29
Molecular weight (Average) 7281.18
Molecular weight (Monoisotopic) 7276.22
Common amino acids GC
Net charge 1
Instability index (II) 20.24
Aliphatic index 44.39
Grand average of hydropathicity (GRAVY) -0.629
Half Life
100 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 20440
Abs 0.1% (=1 g/l) 2.807, assuming all pairs of Cys residues form cystines
Ext. coefficient 19940
Abs 0.1% (=1 g/l) 2.739, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID Not available
Title Not available
Doi Not available
Year Not available
Patent
Patent ID US 2006/0252676 A1
Patent Title Analgesic antitumor peptide from scorpion and method of producing it.
Other Iinformation Granted Patent Family: 10s / 10ex; Family Jurisdictions: US, DE, AT, CN, EP, WO; Legal Status: Active; Application No: 49107704; Filed:Dec 13, 2004; Published: Nov 9, 2006; Earliest Priority: Sep 30, 2001; Granted: Sep 22, 2009
Other Published ID CN1325514C CN1341662A DE60233064D1 EP1443053A1 EP1443053A4 EP1443053B1 US7592309 WO2003037922A1
This work is licensed under a Creative Commons Attribution 4.0 International License.