DCTPep ID  DCTPep01381

Peptide Name   Sequence 57 from Patent US 20110319336

Sequence  MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALGISYGRKKRRQRRRAHQNSQTHQASLSKQPTSQPRGDPTGPKE

Sequence Length  86

UniProt ID  P04608 

PubChem CID  Not available

Origin  Synthetic construct

Type  Synthetic peptide

Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available

PDB ID  Not available

Predicted Structure  DCTPep01381

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity  Not available

Linear/Cyclic  Not available

Disulfide/Other Bond  Not available

N-terminal Modification  Not available

C-terminal Modification  Not available

Other Modification  None

Chiral  L

Grand average of hydropathicity (GRAVY)  -1.213

Half Life 
  30 hours (mammalian reticulocytes, in vitro).
  >20 hours (yeast, in vivo).
  >10 hours (Escherichia coli, in vivo).

Extinction coefficients 
  Ext. coefficient 8855
  Abs 0.1% (=1 g/l) 0.900, assuming all pairs of Cys residues form cystines
  Ext. coefficient 8480
  Abs 0.1% (=1 g/l) 0.862, assuming all Cys residues are reduced

Amino acid distribution

Literature 1

Pubmed ID Not available

Title  Not available

Doi Not available

Year  Not available

Patent

Patent ID US 2011/0319336 A1

Patent Title  Selective anticancer chimeric peptide.

Other Iinformation  Granted Patent Family: 19s / 19ex; Family Jurisdictions: US, JP, EP, WO, CN; Legal Status: Active; Application No: 200913132580; Filed: Dec 3, 2009; Published: Dec 29, 2011; Earliest Priority: Dec 3, 2008; Granted: May 7, 2013

Other Published ID  CN102238965A  EP2370107A2  WO2010064207A2  WO2010064207A3