Peptide Libraray

Sequence 20 from Patent US 20110319336

General Information

DCTPep ID DCTPep01385

Peptide Name Sequence 20 from Patent US 20110319336

Sequence NYQWVPYQGRVPYPRGGGKLLLKLLKKLLKLLKKK

Sequence Length 35

UniProt ID Not available

PubChem CID Not available

Origin Synthetic construct

Type Synthetic peptide

Classification

ACP

Activity Information

Hemolytic Activity Not available

Normal (non-cancerous) Cytotoxicity Not available

Target Not available

Affinity Not available

Mechanism Not available

Structure Information

PDB ID Not available

Predicted Structure DCTPep01385

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity Not available

Linear/Cyclic Not available

Disulfide/Other Bond Not available

N-terminal Modification Not available

C-terminal Modification Not available

Other Modification None

Chiral L

Physicochemical Information

Formula C199H331N53O42

Absent amino acids ACDEFHIMST

Theoretical pI 10.63

Acidic residues 0

Basic residues 10

Polar residues 8

Molecular weight (Average) 4138.15

Molecular weight (Monoisotopic) 4135.54

Common amino acids L

Net charge 10

Instability index (II) 2.46

Aliphatic index 116.86

Grand average of hydropathicity (GRAVY) -0.551

Half Life
1.4 hours (mammalian reticulocytes, in vitro).
3 min (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).

Extinction coefficients
Ext. coefficient 9970
Abs 0.1% (=1 g/l) 2.409

Amino acid distribution

Literature Information

Literature 1

Pubmed ID Not available

Title Not available

Doi Not available

Year Not available

Patent

Patent ID US 2011/0319336 A1

Patent Title Selective anticancer chimeric peptide.

Other Iinformation Granted Patent Family: 19s / 19ex; Family Jurisdictions: US, JP, EP, WO, CN; Legal Status: Active; Application No: 200913132580; Filed: Dec 3, 2009; Published: Dec 29, 2011; Earliest Priority: Dec 3, 2008; Granted: May 7, 2013

Other Published ID CN102238965A EP2370107A2 WO2010064207A2 WO2010064207A3