Peptide Libraray

Sequence 21 from Patent US 20110319336

General Information

DCTPep ID DCTPep01402

Peptide Name Sequence 21 from Patent US 20110319336

Sequence YHWYGYTPQNVIGGGGGRLLRRLLRRLLRK

Sequence Length 30

UniProt ID Not available

PubChem CID Not available

Origin Synthetic construct

Type Synthetic peptide

Classification

ACP

Activity Information

Hemolytic Activity Not available

Normal (non-cancerous) Cytotoxicity Not available

Target Not available

Affinity Not available

Mechanism Not available

Structure Information

PDB ID Not available

Predicted Structure DCTPep01402

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity Not available

Linear/Cyclic Not available

Disulfide/Other Bond Not available

N-terminal Modification Not available

C-terminal Modification Not available

Other Modification None

Chiral L

Physicochemical Information

Formula C163H262N54O37

Absent amino acids ACDEFMS

Theoretical pI 11.72

Acidic residues 0

Basic residues 8

Polar residues 11

Molecular weight (Average) 3570.21

Molecular weight (Monoisotopic) 3568.03

Common amino acids GLR

Net charge 8

Instability index (II) 84.65

Aliphatic index 100.67

Grand average of hydropathicity (GRAVY) -0.637

Half Life
2.8 hours (mammalian reticulocytes, in vitro).
10 min (yeast, in vivo).
2 min (Escherichia coli, in vivo).

Extinction coefficients
Ext. coefficient 9970
Abs 0.1% (=1 g/l) 2.793

Amino acid distribution

Literature Information

Literature 1

Pubmed ID Not available

Title Not available

Doi Not available

Year Not available

Patent

Patent ID US 2011/0319336 A1

Patent Title Selective anticancer chimeric peptide.

Other Iinformation Granted Patent Family: 19s / 19ex; Family Jurisdictions: US, JP, EP, WO, CN; Legal Status: Active; Application No: 200913132580; Filed: Dec 3, 2009; Published: Dec 29, 2011; Earliest Priority: Dec 3, 2008; Granted: May 7, 2013

Other Published ID CN102238965A EP2370107A2 WO2010064207A2 WO2010064207A3