Peptide Libraray

Sequence 7 from Patent US 20120302729

General Information

DCTPep ID DCTPep01415

Peptide Name Sequence 7 from Patent US 20120302729

Sequence KAMQDAEVSKSDIGEVILVGGMTRMPKVQQTVQDLFGRAPSKAVNPDEAV

Sequence Length 50

UniProt ID Not available

PubChem CID Not available

Origin Synthetic construct

Type Synthetic peptide

Classification

ACP

Activity Information

Hemolytic Activity Not available

Normal (non-cancerous) Cytotoxicity Not available

Target Not available

Affinity Not available

Mechanism Not available

Structure Information

PDB ID Not available

Predicted Structure DCTPep01415

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity Not available

Linear/Cyclic Not available

Disulfide/Other Bond Not available

N-terminal Modification Not available

C-terminal Modification Not available

Other Modification None

Chiral L

Physicochemical Information

Formula C229H383N65O75S3

Absent amino acids CHWY

Theoretical pI 5.05

Acidic residues 7

Basic residues 6

Polar residues 10

Molecular weight (Average) 5343.13

Molecular weight (Monoisotopic) 5339.73

Common amino acids V

Net charge -1

Instability index (II) 35.1

Aliphatic index 81.80

Grand average of hydropathicity (GRAVY) -0.266

Half Life
1.3 hours (mammalian reticulocytes, in vitro).
3 min (yeast, in vivo).
3 min (Escherichia coli, in vivo).

Extinction coefficients
Should not be visible by UV spectrophotometry.

Amino acid distribution

Literature Information

Literature 1

Pubmed ID Not available

Title Not available

Doi Not available

Year Not available

Patent

Patent ID US 2012/0302729 A1

Patent Title Anticancer anti-mortalin peptide antibody.

Other Iinformation Granted Patent Family: 8s / 8ex; Family Jurisdictions: EP, US, WO, JP; Legal Status: Inactive; Application No: 201013514755; Filed:Dec 9, 2010; Published: Nov 29, 2012; Earliest Priority: Dec 10, 2009; Granted: Nov 19, 2013

Other Published ID EP2511371A1 EP2511371A4