Sequence 25 from Patent US 20200079827
General Information
DCTPep ID DCTPep01517
Peptide Name Sequence 25 from Patent US 20200079827
Sequence LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLLPRTES
Sequence Length 37
UniProt ID Not available
PubChem CID Not available
Origin Synthetic construct
Type Synthetic peptide
Classification
ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep01517
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Not available
Disulfide/Other Bond Not available
N-terminal Modification Not available
C-terminal Modification Not available
Other Modification None
Chiral L
Physicochemical Information
Formula C206H342N60O53
Absent amino acids ACHMWY
Theoretical pI 10.61
Acidic residues 5
Basic residues 11
Polar residues 6
Molecular weight (Average) 4507.35
Molecular weight (Monoisotopic) 4504.59
Common amino acids K
Net charge 6
Instability index (II) 23.34
Aliphatic index 92.16
Grand average of hydropathicity (GRAVY) -0.735
Half Life
5.5 hours (mammalian reticulocytes, in vitro).
3 min (yeast, in vivo).
2 min (Escherichia coli, in vivo).
Extinction coefficients
Should not be visible by UV spectrophotometry.
Amino acid distribution
Literature Information
Literature 1
Pubmed ID Not available
Title Not available
Doi Not available
Year Not available
Patent
Patent ID US 2020/0079827 A1
Patent Title Novel Antimicrobial And Anti-cancer Therapy
Other Iinformation Granted Patent Family: 6s / 6ex; Family Jurisdictions: EP, IL, AU, US, AT, DEUS, EP, CN, WO; Legal Status: Active; Application No: 201716462586; Filed:Nov 21, 2017; Published: Mar 12, 2020; Earliest Priority: Nov 21, 2016; Granted: Mar 29, 2022
Other Published ID WO2018094403A1 CN109996554A EP3541405A1 EP3541405A4