Sequence 25 from Patent US 20200079827

General Information


DCTPep ID  DCTPep01517

Peptide Name   Sequence 25 from Patent US 20200079827

Sequence  LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLLPRTES

Sequence Length  37

UniProt ID  Not available

PubChem CID  Not available

Origin  Synthetic construct

Type  Synthetic peptide

Classification

  

ACP



Activity Information


Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available



Structure Information


PDB ID  Not available

Predicted Structure  DCTPep01517

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity  Not available

Linear/Cyclic  Not available

Disulfide/Other Bond  Not available

N-terminal Modification  Not available

C-terminal Modification  Not available

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C206H342N60O53

Absent amino acids  ACHMWY

Theoretical pI  10.61

Acidic residues  5

Basic residues  11

Polar residues  6

Molecular weight (Average)  4507.35

Molecular weight (Monoisotopic)  4504.59

Common amino acids  K

Net charge  6

Instability index (II)  23.34

Aliphatic index  92.16

Grand average of hydropathicity (GRAVY)  -0.735

Half Life 
  5.5 hours (mammalian reticulocytes, in vitro).
  3 min (yeast, in vivo).
  2 min (Escherichia coli, in vivo).

Extinction coefficients 
  Should not be visible by UV spectrophotometry.

Amino acid distribution



Literature Information


Literature 1

Pubmed ID Not available

Title  Not available

Doi Not available

Year  Not available

Patent

Patent ID US 2020/0079827 A1

Patent Title  Novel Antimicrobial And Anti-cancer Therapy

Other Iinformation  Granted Patent Family: 6s / 6ex; Family Jurisdictions: EP, IL, AU, US, AT, DEUS, EP, CN, WO; Legal Status: Active; Application No: 201716462586; Filed:Nov 21, 2017; Published: Mar 12, 2020; Earliest Priority: Nov 21, 2016; Granted: Mar 29, 2022

Other Published ID  WO2018094403A1  CN109996554A  EP3541405A1  EP3541405A4 




DCTPep is developed by Dr.Zheng's team.