LSB-37
General Information
DCTPep ID DCTPep01732
Peptide Name LSB-37
Sequence LPKWKVFKKIEKVGRNIRNGIVKAGPAIAVLGEAKALG
Sequence Length 38
UniProt ID Not available
PubChem CID Not available
Origin FLAK peptides
Type Synthetic peptide
Classification
ACP Tumor active peptide
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| NCI-H1299 | Lung large cell carcinoma | LD50=120 µg/ml | MTT assay | 24 h | Patent |
| BMKC | Skin carcinoma | LD50=170 µg/ml | MTT assay | 24 h | Patent |
| SW480 | Colon adenocarcinoma | LD50=240 µg/ml | MTT assay | 24 h | Patent |
| HeLa | Human papillomavirus-related endocervical adenocarcinoma | LD50=250 µg/ml | MTT assay | 24 h | Patent |
| PC-3 | Prostate carcinoma | LD50=370 µg/ml | MTT assay | 24 h | Patent |
| MCF-7 | Invasive breast carcinoma of no special type | LD50=50 µg/ml | MTT assay | 24 h | Patent |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep01732
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Amidation
Other Modification None
Chiral L
Physicochemical Information
Formula C189H322N54O45
Absent amino acids CDHMQSTY
Theoretical pI 10.73
Acidic residues 2
Basic residues 9
Polar residues 7
Molecular weight (Average) 4070.97
Molecular weight (Monoisotopic) 4068.46
Common amino acids K
Net charge 7
Instability index (II) 25.44
Aliphatic index 115.53
Grand average of hydropathicity (GRAVY) 0.042
Half Life
5.5 hours (mammalian reticulocytes, in vitro).
3 min (yeast, in vivo).
2 min (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 5500
Abs 0.1% (=1 g/l) 1.351
Amino acid distribution
Literature Information
Literature 1
Pubmed ID Not available
Title Not available
Doi Not available
Year Not available
Patent
Patent ID US2005/0209157A1
Patent Title Short bioactive peptides and methods for their use
Other Iinformation Patent Application; Family: 1s / 24ex; Family Jurisdictions: US; Legal Status: Discontinued; Application No: 13618605; Filed: May 24, 2005; Published: Sep 22, 2005; Earliest Priority: Mar 28, 2001
Other Published ID Not available