Peptide Libraray

LSB-37

General Information

DCTPep ID DCTPep01732

Peptide Name LSB-37

Sequence LPKWKVFKKIEKVGRNIRNGIVKAGPAIAVLGEAKALG

Sequence Length 38

UniProt ID Not available

PubChem CID Not available

Origin FLAK peptides

Type Synthetic peptide

Classification

ACP Tumor active peptide

Activity Information

Cell Line	Disease	Activity	Assay	Testing Time	Literature
NCI-H1299	Lung large cell carcinoma	LD50=120 µg/ml	MTT assay	24 h	Patent
BMKC	Skin carcinoma	LD50=170 µg/ml	MTT assay	24 h	Patent
SW480	Colon adenocarcinoma	LD50=240 µg/ml	MTT assay	24 h	Patent
HeLa	Human papillomavirus-related endocervical adenocarcinoma	LD50=250 µg/ml	MTT assay	24 h	Patent
PC-3	Prostate carcinoma	LD50=370 µg/ml	MTT assay	24 h	Patent
MCF-7	Invasive breast carcinoma of no special type	LD50=50 µg/ml	MTT assay	24 h	Patent

Hemolytic Activity Not available

Normal (non-cancerous) Cytotoxicity Not available

Target Not available

Affinity Not available

Mechanism Not available

Structure Information

PDB ID Not available

Predicted Structure DCTPep01732

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity Not available

Linear/Cyclic Linear

Disulfide/Other Bond Not available

N-terminal Modification Free

C-terminal Modification Amidation

Other Modification None

Chiral L

Physicochemical Information

Formula C189H322N54O45

Absent amino acids CDHMQSTY

Theoretical pI 10.73

Acidic residues 2

Basic residues 9

Polar residues 7

Molecular weight (Average) 4070.97

Molecular weight (Monoisotopic) 4068.46

Common amino acids K

Net charge 7

Instability index (II) 25.44

Aliphatic index 115.53

Grand average of hydropathicity (GRAVY) 0.042

Half Life
5.5 hours (mammalian reticulocytes, in vitro).
3 min (yeast, in vivo).
2 min (Escherichia coli, in vivo).

Extinction coefficients
Ext. coefficient 5500
Abs 0.1% (=1 g/l) 1.351

Amino acid distribution

Literature Information

Literature 1

Pubmed ID Not available

Title Not available

Doi Not available

Year Not available

Patent

Patent ID US2005/0209157A1

Patent Title Short bioactive peptides and methods for their use

Other Iinformation Patent Application; Family: 1s / 24ex; Family Jurisdictions: US; Legal Status: Discontinued; Application No: 13618605; Filed: May 24, 2005; Published: Sep 22, 2005; Earliest Priority: Mar 28, 2001

Other Published ID Not available