SB-37 AC
General Information
DCTPep ID DCTPep01734
Peptide Name SB-37 AC
Sequence MPKWKVFKKIEKVGRNIRNGIVKAGPAIAVLGEAKALG
Sequence Length 38
UniProt ID Not available
PubChem CID 16131655
Origin FLAK peptides
Type Synthetic peptide
Classification
ACP Tumor active peptide
Activity Information
Cell Line | Disease | Activity | Assay | Testing Time | Literature |
---|---|---|---|---|---|
BMKC | Skin carcinoma | LD50=120 µg/ml | MTT assay | 24 h | Patent |
HeLa | Human papillomavirus-related endocervical adenocarcinoma | LD50=150 µg/ml | MTT assay | 24 h | Patent |
MCF-7 | Invasive breast carcinoma of no special type | LD50=175 µg/ml | MTT assay | 24 h | Patent |
NCI-H1299 | Lung large cell carcinoma | LD50=220 µg/ml | MTT assay | 24 h | Patent |
SW480 | Colon adenocarcinoma | LD50=82 µg/ml | MTT assay | 24 h | Patent |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep01734
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C188H320N54O45S1
Absent amino acids CDHQSTY
Theoretical pI 10.73
Acidic residues 2
Basic residues 9
Polar residues 7
Molecular weight (Average) 4089
Molecular weight (Monoisotopic) 4086.41
Common amino acids K
Net charge 7
Instability index (II) 31.93
Aliphatic index 105.26
Grand average of hydropathicity (GRAVY) -0.008
Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 5500
Abs 0.1% (=1 g/l) 1.345
Amino acid distribution
Literature Information
Literature 1
Pubmed ID Not available
Title Not available
Doi Not available
Year Not available
Patent
Patent ID US2005/0209157A1
Patent Title Short bioactive peptides and methods for their use
Other Iinformation Patent Application; Family: 1s / 24ex; Family Jurisdictions: US; Legal Status: Discontinued; Application No: 13618605; Filed: May 24, 2005; Published: Sep 22, 2005; Earliest Priority: Mar 28, 2001
Other Published ID Not available