Peptide Libraray

SB-37 AM

General Information

DCTPep ID DCTPep01735

Peptide Name SB-37 AM

Sequence MPKWKVFKKIEKVGRNIRNGIVKAGPAIAVLGEAKALG

Sequence Length 38

UniProt ID Not available

PubChem CID Not available

Origin FLAK peptides

Type Synthetic peptide

Classification

ACP Tumor active peptide

Activity Information

Cell Line	Disease	Activity	Assay	Testing Time	Literature
BMKC	Skin carcinoma	LD50=1000 µg/ml	MTT assay	24 h	Patent
HeLa	Human papillomavirus-related endocervical adenocarcinoma	LD50=1000 µg/ml	MTT assay	24 h	Patent
SW480	Colon adenocarcinoma	LD50=1000 µg/ml	MTT assay	24 h	Patent
MCF-7	Invasive breast carcinoma of no special type	LD50=540 µg/ml	MTT assay	24 h	Patent
PC-3	Prostate carcinoma	LD50=630 µg/ml	MTT assay	24 h	Patent
NCI-H1299	Lung large cell carcinoma	LD50=720 µg/ml	MTT assay	24 h	Patent

Hemolytic Activity Not available

Normal (non-cancerous) Cytotoxicity Not available

Target Not available

Affinity Not available

Mechanism Not available

Structure Information

PDB ID Not available

Predicted Structure DCTPep01735

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity Not available

Linear/Cyclic Linear

Disulfide/Other Bond Not available

N-terminal Modification Free

C-terminal Modification Amidation

Other Modification None

Chiral L

Physicochemical Information

Formula C188H320N54O45S1

Absent amino acids CDHQSTY

Theoretical pI 10.73

Acidic residues 2

Basic residues 9

Polar residues 7

Molecular weight (Average) 4089

Molecular weight (Monoisotopic) 4086.41

Common amino acids K

Net charge 7

Instability index (II) 31.93

Aliphatic index 105.26

Grand average of hydropathicity (GRAVY) -0.008

Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).

Extinction coefficients
Ext. coefficient 5500
Abs 0.1% (=1 g/l) 1.345

Amino acid distribution

Literature Information

Literature 1

Pubmed ID Not available

Title Not available

Doi Not available

Year Not available

Patent

Patent ID US2005/0209157A1

Patent Title Short bioactive peptides and methods for their use

Other Iinformation Patent Application; Family: 1s / 24ex; Family Jurisdictions: US; Legal Status: Discontinued; Application No: 13618605; Filed: May 24, 2005; Published: Sep 22, 2005; Earliest Priority: Mar 28, 2001

Other Published ID Not available