SB-37 AM

General Information


DCTPep ID  DCTPep01735

Peptide Name   SB-37 AM

Sequence  MPKWKVFKKIEKVGRNIRNGIVKAGPAIAVLGEAKALG

Sequence Length  38

UniProt ID  Not available

PubChem CID  Not available

Origin  FLAK peptides

Type  Synthetic peptide

Classification

  

ACP Tumor active peptide



Activity Information


Cell Line Disease Activity Assay Testing Time Literature
BMKC Skin carcinoma LD50=1000 µg/ml MTT assay 24 h Patent
HeLa Human papillomavirus-related endocervical adenocarcinoma LD50=1000 µg/ml MTT assay 24 h Patent
SW480 Colon adenocarcinoma LD50=1000 µg/ml MTT assay 24 h Patent
MCF-7 Invasive breast carcinoma of no special type LD50=540 µg/ml MTT assay 24 h Patent
PC-3 Prostate carcinoma LD50=630 µg/ml MTT assay 24 h Patent
NCI-H1299 Lung large cell carcinoma LD50=720 µg/ml MTT assay 24 h Patent

Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available



Structure Information


PDB ID  Not available

Predicted Structure  DCTPep01735

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Amidation

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C188H320N54O45S1

Absent amino acids  CDHQSTY

Theoretical pI  10.73

Acidic residues  2

Basic residues  9

Polar residues  7

Molecular weight (Average)  4089

Molecular weight (Monoisotopic)  4086.41

Common amino acids  K

Net charge  7

Instability index (II)  31.93

Aliphatic index  105.26

Grand average of hydropathicity (GRAVY)  -0.008

Half Life 
  30 hours (mammalian reticulocytes, in vitro).
  >20 hours (yeast, in vivo).
  >10 hours (Escherichia coli, in vivo).

Extinction coefficients 
  Ext. coefficient 5500
  Abs 0.1% (=1 g/l) 1.345

Amino acid distribution



Literature Information


Literature 1

Pubmed ID Not available

Title  Not available

Doi Not available

Year  Not available

Patent

Patent ID US2005/0209157A1

Patent Title  Short bioactive peptides and methods for their use

Other Iinformation  Patent Application; Family: 1s / 24ex; Family Jurisdictions: US; Legal Status: Discontinued; Application No: 13618605; Filed: May 24, 2005; Published: Sep 22, 2005; Earliest Priority: Mar 28, 2001

Other Published ID  Not available




DCTPep is developed by Dr.Zheng's team.