Peptide Libraray

pDBD * 4R9

General Information

DCTPep ID DCTPep01752

Peptide Name pDBD * 4R9

Sequence YLCAGRNDCIIAIKFEEKTAQHAAIENVFRLERRRRRRRRR

Sequence Length 41

UniProt ID Not available

PubChem CID Not available

Origin Synthetics

Type Synthetic peptide

Classification

ACP

Activity Information

Hemolytic Activity Not available

Normal (non-cancerous) Cytotoxicity NIH 3T3: Barely toxic

Target Not available

Affinity Not available

Mechanism Not available

Structure Information

PDB ID Not available

Predicted Structure DCTPep01752

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity Not available

Linear/Cyclic Linear

Disulfide/Other Bond Not available

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Chiral L

Physicochemical Information

Formula C216H365N81O57S2

Absent amino acids MPSW

Theoretical pI 11.38

Acidic residues 5

Basic residues 14

Polar residues 7

Molecular weight (Average) 5072.9

Molecular weight (Monoisotopic) 5069.76

Common amino acids R

Net charge 9

Instability index (II) 141.13

Aliphatic index 76.34

Grand average of hydropathicity (GRAVY) -1.012

Half Life
2.8 hours (mammalian reticulocytes, in vitro).
10 min (yeast, in vivo).
2 min (Escherichia coli, in vivo).

Extinction coefficients
Ext. coefficient 1615
Abs 0.1% (=1 g/l) 0.318, assuming all pairs of Cys residues form cystines
Ext. coefficient 1490
Abs 0.1% (=1 g/l) 0.294, assuming all Cys residues are reduced

Amino acid distribution

Literature Information

Literature 1

Pubmed ID Not available

Title Not available

Doi Not available

Year Not available

Patent

Patent ID US2006/0100147A1

Patent Title Anticancer peptide

Other Iinformation Patent Application; Family: 2s / 2ex; Family Jurisdictions: US; Legal Status: Discontinued; Application No: 23095205; Filed: Sep 19, 2005; Published: May 11, 2006; Earliest Priority: Sep 20, 2004

Other Published ID US2009203594A1