Sequence 1 from Patent US 20060100147

General Information


DCTPep ID  DCTPep01759

Peptide Name   Sequence 1 from Patent US 20060100147

Sequence  YLCAGRNDCIIAIKFEEKTAQHAAIENVFRLE

Sequence Length  32

UniProt ID  Not available

PubChem CID  Not available

Origin  Synthetic construct

Type  Synthetic peptide

Classification

  

ACP



Activity Information


Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available



Structure Information


PDB ID  Not available

Predicted Structure  DCTPep01759

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C162H257N45O48S2

Absent amino acids  MPSW

Theoretical pI  5.59

Acidic residues  5

Basic residues  5

Polar residues  7

Molecular weight (Average)  3667.22

Molecular weight (Monoisotopic)  3664.85

Common amino acids  A

Net charge  0

Instability index (II)  34.81

Aliphatic index  97.81

Grand average of hydropathicity (GRAVY)  -0.031

Half Life 
  2.8 hours (mammalian reticulocytes, in vitro).
  10 min (yeast, in vivo).
  2 min (Escherichia coli, in vivo).

Extinction coefficients 
  Ext. coefficient 1615
  Abs 0.1% (=1 g/l) 0.440, assuming all pairs of Cys residues form cystines
  Ext. coefficient 1490
  Abs 0.1% (=1 g/l) 0.406, assuming all Cys residues are reduced

Amino acid distribution



Literature Information


Literature 1

Pubmed ID Not available

Title  Not available

Doi Not available

Year  Not available

Patent

Patent ID US20090203594

Patent Title  Anticancer peptide.

Other Iinformation  Patent Application Family: 2s / 2ex; Family Jurisdictions: US; Legal Status: Discontinued; Application No: 286507; Filed: Dec 19, 2007; Published: Aug 13, 2009; Earliest Priority: Sep 20, 2004

Other Published ID  US20090203594 




DCTPep is developed by Dr.Zheng's team.