Peptide Libraray

Sequence 1 from Patent US 20060100147

General Information

DCTPep ID DCTPep01759

Peptide Name Sequence 1 from Patent US 20060100147

Sequence YLCAGRNDCIIAIKFEEKTAQHAAIENVFRLE

Sequence Length 32

UniProt ID Not available

PubChem CID Not available

Origin Synthetic construct

Type Synthetic peptide

Classification

ACP

Activity Information

Hemolytic Activity Not available

Normal (non-cancerous) Cytotoxicity Not available

Target Not available

Affinity Not available

Mechanism Not available

Structure Information

PDB ID Not available

Predicted Structure DCTPep01759

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity Not available

Linear/Cyclic Linear

Disulfide/Other Bond Not available

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Chiral L

Physicochemical Information

Formula C162H257N45O48S2

Absent amino acids MPSW

Theoretical pI 5.59

Acidic residues 5

Basic residues 5

Polar residues 7

Molecular weight (Average) 3667.22

Molecular weight (Monoisotopic) 3664.85

Common amino acids A

Net charge 0

Instability index (II) 34.81

Aliphatic index 97.81

Grand average of hydropathicity (GRAVY) -0.031

Half Life
2.8 hours (mammalian reticulocytes, in vitro).
10 min (yeast, in vivo).
2 min (Escherichia coli, in vivo).

Extinction coefficients
Ext. coefficient 1615
Abs 0.1% (=1 g/l) 0.440, assuming all pairs of Cys residues form cystines
Ext. coefficient 1490
Abs 0.1% (=1 g/l) 0.406, assuming all Cys residues are reduced

Amino acid distribution

Literature Information

Literature 1

Pubmed ID Not available

Title Not available

Doi Not available

Year Not available

Patent

Patent ID US20090203594

Patent Title Anticancer peptide.

Other Iinformation Patent Application Family: 2s / 2ex; Family Jurisdictions: US; Legal Status: Discontinued; Application No: 286507; Filed: Dec 19, 2007; Published: Aug 13, 2009; Earliest Priority: Sep 20, 2004

Other Published ID US20090203594