Peptide Libraray

Kr1(1-91 ActiveZone)frag SEQ ID NO: 19

General Information

DCTPep ID DCTPep01767

Peptide Name Kr1(1-91 ActiveZone)frag SEQ ID NO: 19

Sequence GSNKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDS

Sequence Length 91

UniProt ID Q01973

PubChem CID Not available

Origin Not available

Type Synthetic peptide

Classification

ACP Tumor active peptide Cancer targeted peptides

Activity Information

Cell Line	Disease	Activity	Assay	Testing Time	Literature
DA-3 [Mouse lymphoma]	Mouse lymphoma	Proliferation Inhibition (5 day) IC50=13 nM	WST-8 assay	5 days	Patent
BT-549	Invasive breast carcinoma of no special type	Proliferation Inhibition (5 day) IC50=14400 nM	WST-8 assay	5 days	Patent
U-118MG	Astrocytoma	Proliferation Inhibition (5 day) IC50=20 nM	WST-8 assay	5 days	Patent
DLD-1	Colon adenocarcinoma	Proliferation Inhibition (5 day) IC50=250 nM	WST-8 assay	5 days	Patent
4T1	Malignant neoplasms of the mouse mammary gland	Proliferation Inhibition (5 day) IC50=3254 nM	WST-8 assay	5 days	Patent
HT-29	Colon adenocarcinoma	When the concentrations of peptides were 0.1 μg/ml, 1 μg/ml, and 10 μg/ml, the % Proliferation Inhibition was 0 ± 8, 10 ± 9, 0 ± 5.	WST-8 assay	72 h	Patent
U-87MG ATCC	Glioblastoma	When the concentrations of peptides were 0.1 μg/ml, 1 μg/ml, and 10 μg/ml, the % Proliferation Inhibition was 12 ± 7, 45 ± 7, 82 ± 8.	WST-8 assay	72 h	Patent
Calu-6	Lung adenocarcinoma	When the concentrations of peptides were 0.1 μg/ml, 1 μg/ml, and 10 μg/ml, the % Proliferation Inhibition was 14 ± 2, 31 ± 5, 60 ± 5.	WST-8 assay	72 h	Patent
D-54MG	Glioblastoma	When the concentrations of peptides were 0.1 μg/ml, 1 μg/ml, and 10 μg/ml, the % Proliferation Inhibition was 15 ± 3, 52 ± 6, 85 ± 3.	WST-8 assay	72 h	Patent
MDA-MB-231	Breast adenocarcinoma	When the concentrations of peptides were 0.1 μg/ml, 1 μg/ml, and 10 μg/ml, the % Proliferation Inhibition was 33 ± 8, 63 ± 12, 86 ± 10.	WST-8 assay	72 h	Patent

Hemolytic Activity Not available

Normal (non-cancerous) Cytotoxicity 293 Kidney fibroblasts: When the concentrations of peptides were 0.1 μg/ml, 1 μg/ml, and 10 μg/ml, the % Proliferation Inhibition was 0 ± 5, 0 ± 6, 0 ± 7.

Target tyrosine kinase orphan receptors (RORs)

Affinity Not available

Mechanism Not available

Structure Information

PDB ID Not available

Predicted Structure DCTPep01767

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity Not available

Linear/Cyclic Linear

Disulfide/Other Bond Not available

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Chiral L

Physicochemical Information

Formula C440H657N131O142S6

Absent amino acids M

Theoretical pI 7.79

Acidic residues 9

Basic residues 14

Polar residues 41

Molecular weight (Average) 10246.21

Molecular weight (Monoisotopic) 10239.65

Common amino acids SN

Net charge 5

Instability index (II) 32.53

Aliphatic index 34.29

Grand average of hydropathicity (GRAVY) -1.047

Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).

Extinction coefficients
Ext. coefficient 17335
Abs 0.1% (=1 g/l) 1.692, assuming all pairs of Cys residues form cystines
Ext. coefficient 16960
Abs 0.1% (=1 g/l) 1.655, assuming all Cys residues are reduced

Amino acid distribution

Literature Information

Literature 1

Pubmed ID Not available

Title Not available

Doi Not available

Year Not available

Patent

Patent ID US2019/0142913A1

Patent Title Grp78 Antagonist That Block Binding of Receptor Tyrosine Kinase Orphan Receptors as Immunotherapy Anticancer Agents

Other Iinformation Patent Application; Family: 2s / 2ex; Family Jurisdictions: US; Legal Status: Active; Application No: 201816184247; Filed: Nov 8, 2018; Published: May 16, 2019; Earliest Priority: Nov 10, 2017; Granted: Feb 2, 2021

Other Published ID US10905750B2