Kr1(1-91 ActiveZone)frag SEQ ID NO: 19
General Information
DCTPep ID DCTPep01767
Peptide Name Kr1(1-91 ActiveZone)frag SEQ ID NO: 19
Sequence GSNKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDS
Sequence Length 91
UniProt ID Q01973
PubChem CID Not available
Origin Not available
Type Synthetic peptide
Classification
ACP Tumor active peptide Cancer targeted peptides
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| DA-3 [Mouse lymphoma] | Mouse lymphoma | Proliferation Inhibition (5 day) IC50=13 nM | WST-8 assay | 5 days | Patent |
| BT-549 | Invasive breast carcinoma of no special type | Proliferation Inhibition (5 day) IC50=14400 nM | WST-8 assay | 5 days | Patent |
| U-118MG | Astrocytoma | Proliferation Inhibition (5 day) IC50=20 nM | WST-8 assay | 5 days | Patent |
| DLD-1 | Colon adenocarcinoma | Proliferation Inhibition (5 day) IC50=250 nM | WST-8 assay | 5 days | Patent |
| 4T1 | Malignant neoplasms of the mouse mammary gland | Proliferation Inhibition (5 day) IC50=3254 nM | WST-8 assay | 5 days | Patent |
| HT-29 | Colon adenocarcinoma | When the concentrations of peptides were 0.1 μg/ml, 1 μg/ml, and 10 μg/ml, the % Proliferation Inhibition was 0 ± 8, 10 ± 9, 0 ± 5. | WST-8 assay | 72 h | Patent |
| U-87MG ATCC | Glioblastoma | When the concentrations of peptides were 0.1 μg/ml, 1 μg/ml, and 10 μg/ml, the % Proliferation Inhibition was 12 ± 7, 45 ± 7, 82 ± 8. | WST-8 assay | 72 h | Patent |
| Calu-6 | Lung adenocarcinoma | When the concentrations of peptides were 0.1 μg/ml, 1 μg/ml, and 10 μg/ml, the % Proliferation Inhibition was 14 ± 2, 31 ± 5, 60 ± 5. | WST-8 assay | 72 h | Patent |
| D-54MG | Glioblastoma | When the concentrations of peptides were 0.1 μg/ml, 1 μg/ml, and 10 μg/ml, the % Proliferation Inhibition was 15 ± 3, 52 ± 6, 85 ± 3. | WST-8 assay | 72 h | Patent |
| MDA-MB-231 | Breast adenocarcinoma | When the concentrations of peptides were 0.1 μg/ml, 1 μg/ml, and 10 μg/ml, the % Proliferation Inhibition was 33 ± 8, 63 ± 12, 86 ± 10. | WST-8 assay | 72 h | Patent |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity 293 Kidney fibroblasts: When the concentrations of peptides were 0.1 μg/ml, 1 μg/ml, and 10 μg/ml, the % Proliferation Inhibition was 0 ± 5, 0 ± 6, 0 ± 7.
Target tyrosine kinase orphan receptors (RORs)
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep01767
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C440H657N131O142S6
Absent amino acids M
Theoretical pI 7.79
Acidic residues 9
Basic residues 14
Polar residues 41
Molecular weight (Average) 10246.21
Molecular weight (Monoisotopic) 10239.65
Common amino acids SN
Net charge 5
Instability index (II) 32.53
Aliphatic index 34.29
Grand average of hydropathicity (GRAVY) -1.047
Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 17335
Abs 0.1% (=1 g/l) 1.692, assuming all pairs of Cys residues form cystines
Ext. coefficient 16960
Abs 0.1% (=1 g/l) 1.655, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID Not available
Title Not available
Doi Not available
Year Not available
Patent
Patent ID US2019/0142913A1
Patent Title Grp78 Antagonist That Block Binding of Receptor Tyrosine Kinase Orphan Receptors as Immunotherapy Anticancer Agents
Other Iinformation Patent Application; Family: 2s / 2ex; Family Jurisdictions: US; Legal Status: Active; Application No: 201816184247; Filed: Nov 8, 2018; Published: May 16, 2019; Earliest Priority: Nov 10, 2017; Granted: Feb 2, 2021
Other Published ID US10905750B2