Peptide Libraray

Kr1(3-91 ActiveZone)frag-Fc SEQ ID NO: 20

General Information

DCTPep ID DCTPep01768

Peptide Name Kr1(3-91 ActiveZone)frag-Fc SEQ ID NO: 20

Sequence NHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSCD

Sequence Length 89

UniProt ID Q01973

PubChem CID Not available

Origin Not available

Type Synthetic peptide

Classification

ACP Tumor active peptide Cancer targeted peptides

Activity Information

Cell Line	Disease	Activity	Assay	Testing Time	Literature
U-118MG	Astrocytoma	Proliferation Inhibition (5 day) IC50=1.4 nM	WST-8 assay	5 days	Patent
BT-549	Invasive breast carcinoma of no special type	Proliferation Inhibition (5 day) IC50=13 nM	WST-8 assay	5 days	Patent
4T1	Malignant neoplasms of the mouse mammary gland	Proliferation Inhibition (5 day) IC50=7 nM	WST-8 assay	5 days	Patent
DLD-1	Colon adenocarcinoma	Proliferation Inhibition (5 day) IC50=9 nM	WST-8 assay	5 days	Patent

Hemolytic Activity Not available

Normal (non-cancerous) Cytotoxicity Not available

Target tyrosine kinase orphan receptors (RORs)

Affinity Not available

Mechanism Not available

Structure Information

PDB ID Not available

Predicted Structure DCTPep01768

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity Not available

Linear/Cyclic Linear

Disulfide/Other Bond Not available

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Chiral L

Physicochemical Information

Formula C432H641N127O140S7

Absent amino acids M

Theoretical pI 6.43

Acidic residues 10

Basic residues 13

Polar residues 39

Molecular weight (Average) 10078.03

Molecular weight (Monoisotopic) 10071.5

Common amino acids SCDNT

Net charge 3

Instability index (II) 36.2

Aliphatic index 35.06

Grand average of hydropathicity (GRAVY) -0.985

Half Life
1.4 hours (mammalian reticulocytes, in vitro).
3 min (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).

Extinction coefficients
Ext. coefficient 17335
Abs 0.1% (=1 g/l) 1.720, assuming all pairs of Cys residues form cystines
Ext. coefficient 16960
Abs 0.1% (=1 g/l) 1.683, assuming all Cys residues are reduced

Amino acid distribution

Literature Information

Literature 1

Pubmed ID Not available

Title Not available

Doi Not available

Year Not available

Patent

Patent ID US2019/0142913A1

Patent Title Grp78 Antagonist That Block Binding of Receptor Tyrosine Kinase Orphan Receptors as Immunotherapy Anticancer Agents

Other Iinformation Patent Application; Family: 2s / 2ex; Family Jurisdictions: US; Legal Status: Active; Application No: 201816184247; Filed: Nov 8, 2018; Published: May 16, 2019; Earliest Priority: Nov 10, 2017; Granted: Feb 2, 2021

Other Published ID US10905750B2