This work is licensed under a Creative Commons Attribution 4.0 International License.
IDP-LLCb02
General Information
DCTPep ID DCTPep01786
Peptide Name IDP-LLCb02
Sequence RQIKWFQNRRMKWKKSKAPKVVILSKALEYLQA
Sequence Length 25
PubChem CID Not available
Origin Synthetics
Type Synthetic peptide
Classification
ACP Tumor active peptide Coupling peptide
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| NCI-H82 | Lung small cell carcinoma; Small cell lung cancer | EC50≈10 μM | MTT assay | Not available | Patent |
| NCI-H510A | Lung small cell carcinoma; Small cell lung cancer | EC50≈15 μM | MTT assay | Not available | Patent |
| NCI-H187 | Lung small cell carcinoma; Small cell lung cancer | EC50≈7.5 μM | MTT assay | Not available | Patent |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep01786
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C189H311N55O43S1
Absent amino acids CDGHT
Theoretical pI 11.24
Acidic residues 1
Basic residues 10
Polar residues 4
Molecular weight (Average) 4073.95
Molecular weight (Monoisotopic) 4071.36
Common amino acids K
Net charge 9
Instability index (II) 49.3
Aliphatic index 85.76
Grand average of hydropathicity (GRAVY) -0.779
Half Life
1 hours (mammalian reticulocytes, in vitro).
2 min (yeast, in vivo).
2 min (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 12490
Abs 0.1% (=1 g/l) 3.066
Amino acid distribution
Literature Information
Literature 1
Pubmed ID Not available
Title Not available
Doi Not available
Year Not available
Patent
Patent ID CN111511761A
Patent Title Anticancer Peptides
Other Iinformation Patent Application; Family: 8s / 8ex; Family Jurisdictions: CA, CN, US, AU, JP, EP, WO, KR; Legal Status: Pending; Application No: 201816635902; Filed: Jul 31, 2018; Published: May 21, 2020; Earliest Priority: Aug 1, 2017
Other Published ID AU2018311129A1 CA3071601A1 CN111436200A EP3661947A1 JP2020529429A KR20200032730A WO2019025432A1
This work is licensed under a Creative Commons Attribution 4.0 International License.