Peptide Libraray

MB30

General Information

DCTPep ID DCTPep01828

Peptide Name MB30

Sequence GQVWEATATVNAIRGSVTPAVSQFNARTAD

Sequence Length 30

UniProt ID P0A5Q3

PubChem CID Not available

Origin Derived from the MPT63 secreted protein

Type Synthetic peptide

Classification

ACP Tumor active peptide

Activity Information

Cell Line	Disease	Activity	Assay	Testing Time	Literature
Ca Ski	Human papillomavirus-related cervical squamous cell carcinoma; Squamous cell carcinoma of the cervix uteri	~20% cytotoxicity at 1 µM	MTT assay	24 h	Patent
Ca Ski	Human papillomavirus-related cervical squamous cell carcinoma; Squamous cell carcinoma of the cervix uteri	~20% cytotoxicity at 1 µM	MTT assay	48 h	Patent
Ca Ski	Human papillomavirus-related cervical squamous cell carcinoma; Squamous cell carcinoma of the cervix uteri	~20% cytotoxicity at 1 µM	MTT assay	72 h	Patent
SiHa	Human papillomavirus-related cervical squamous cell carcinoma; Squamous cell carcinoma of the cervix uteri	~20% cytotoxicity at 1 µM	MTT assay	72 h	Patent
COLO 205	Colon adenocarcinoma	~20% cytotoxicity at 10 µM	MTT assay	72 h	Patent
HTB-9(5637)	Bladder carcinoma	~30% cytotoxicity at 1 µM	MTT assay	72 h	Patent
UM-UC-3	Bladder carcinoma	~30% cytotoxicity at 1 µM	MTT assay	24 h	Patent
COLO 205	Colon adenocarcinoma	~35% cytotoxicity at 10 µM	MTT assay	48 h	Patent
Ca Ski	Human papillomavirus-related cervical squamous cell carcinoma; Squamous cell carcinoma of the cervix uteri	~40% cytotoxicity at 10 µM	MTT assay	24 h	Patent
HCT 116	Colon carcinoma	~40% cytotoxicity at 10 µM	MTT assay	72 h	Patent
Ca Ski	Human papillomavirus-related cervical squamous cell carcinoma; Squamous cell carcinoma of the cervix uteri	~45% cytotoxicity at 10 µM	MTT assay	72 h	Patent
SiHa	Human papillomavirus-related cervical squamous cell carcinoma; Squamous cell carcinoma of the cervix uteri	~45% cytotoxicity at 10 µM	MTT assay	72 h	Patent
HTB-9(5637)	Bladder carcinoma	~50% cytotoxicity at 10 µM	MTT assay	24 h	Patent
SiHa	Human papillomavirus-related cervical squamous cell carcinoma; Squamous cell carcinoma of the cervix uteri	~50% cytotoxicity at 10 µM	MTT assay	48 h	Patent
UM-UC-3	Bladder carcinoma	~50% cytotoxicity at 10 µM	MTT assay	48 h	Patent
UM-UC-3	Bladder carcinoma	~50% cytotoxicity at 10 µM	MTT assay	72 h	Patent
Ca Ski	Human papillomavirus-related cervical squamous cell carcinoma; Squamous cell carcinoma of the cervix uteri	~55% cytotoxicity at 10 µM	MTT assay	48 h	Patent
HCT 116	Colon carcinoma	<20% cytotoxicity at 1 µM	MTT assay	48 h	Patent
HTB-9(5637)	Bladder carcinoma	<20% cytotoxicity at 1 µM	MTT assay	48 h	Patent
SiHa	Human papillomavirus-related cervical squamous cell carcinoma; Squamous cell carcinoma of the cervix uteri	<20% cytotoxicity at 1 µM	MTT assay	48 h	Patent
UM-UC-3	Bladder carcinoma	<30% cytotoxicity at 1 µM	MTT assay	48 h	Patent
UM-UC-3	Bladder carcinoma	<30% cytotoxicity at 10 µM	MTT assay	24 h	Patent
COLO 205	Colon adenocarcinoma	<5% cytotoxicity at 1 µM	MTT assay	24 h	Patent
COLO 205	Colon adenocarcinoma	<5% cytotoxicity at 1 µM	MTT assay	72 h	Patent
COLO 205	Colon adenocarcinoma	<5% cytotoxicity at 10 µM	MTT assay	24 h	Patent
COLO 205	Colon adenocarcinoma	>20% cytotoxicity at 1 µM	MTT assay	48 h	Patent
SiHa	Human papillomavirus-related cervical squamous cell carcinoma; Squamous cell carcinoma of the cervix uteri	>20% cytotoxicity at 1 µM	MTT assay	24 h	Patent
HCT 116	Colon carcinoma	>20% cytotoxicity at 10 µM	MTT assay	48 h	Patent
HCT 116	Colon carcinoma	>30% cytotoxicity at 1 µM	MTT assay	72 h	Patent
HCT 116	Colon carcinoma	>40% cytotoxicity at 1 µM	MTT assay	24 h	Patent
UM-UC-3	Bladder carcinoma	>40% cytotoxicity at 1 µM	MTT assay	72 h	Patent
HTB-9(5637)	Bladder carcinoma	>40% cytotoxicity at 10 µM	MTT assay	72 h	Patent
SiHa	Human papillomavirus-related cervical squamous cell carcinoma; Squamous cell carcinoma of the cervix uteri	>40% cytotoxicity at 10 µM	MTT assay	24 h	Patent
HTB-9(5637)	Bladder carcinoma	20% cytotoxicity at 10 µM	MTT assay	48 h	Patent
HTB-9(5637)	Bladder carcinoma	40% cytotoxicity at 1 µM	MTT assay	24 h	Patent
HCT 116	Colon carcinoma	50% cytotoxicity at 10 µM	MTT assay	24 h	Patent

Hemolytic Activity Not available

Normal (non-cancerous) Cytotoxicity Not available

Target Not available

Affinity Not available

Mechanism Not available

Structure Information

PDB ID Not available

Predicted Structure DCTPep01828

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity Not available

Linear/Cyclic Linear

Disulfide/Other Bond Not available

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Chiral L

Physicochemical Information

Formula C134H213N41O45

Absent amino acids CHKLMY

Theoretical pI 6.07

Acidic residues 2

Basic residues 2

Polar residues 10

Molecular weight (Average) 3118.41

Molecular weight (Monoisotopic) 3116.56

Common amino acids A

Net charge 0

Instability index (II) 8.99

Aliphatic index 71.67

Grand average of hydropathicity (GRAVY) -0.093

Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).

Extinction coefficients
Ext. coefficient 5500
Abs 0.1% (=1 g/l) 1.764

Amino acid distribution

Literature Information

Literature 1

Pubmed ID Not available

Title Not available

Doi Not available

Year Not available

Patent

Patent ID WO2012042540A2

Patent Title Anticancer Agent

Other Iinformation Patent Application; Family: 8s / 8ex; Family Jurisdictions: JP, US, WO, EP; Legal Status: Pending; Application No: 2011000680; Filed: Sep 30, 2011; Published: Apr 5, 2012; Earliest Priority: Oct 1, 2010

Other Published ID WO2012042540A9 EP2621510A2 EP2621510A4 JP2013543493A JP5873499B2 US2014051643A1 US9624277B2