Peptide Libraray

vitri F

General Information

DCTPep ID DCTPep01844

Peptide Name vitri F

Sequence GTLPCGESCVWIPCISSVVGCACKSKVCYKD

Sequence Length 31

UniProt ID Not available

PubChem CID Not available

Origin Viola tricolor

Type Native peptide

Classification

ACP Tumor active peptide Membrane-targeted

Activity Information

Cell Line	Disease	Activity	Assay	Testing Time	Literature
BEL-7402	Human papillomavirus-related endocervical adenocarcinoma	IC50=5.36 µg/ml	SRB assay	48 h	1

Hemolytic Activity HRBCs: HC50=10.00 μM

Normal (non-cancerous) Cytotoxicity Not available

Target Not available

Affinity Not available

Mechanism Not available

Structure Information

PDB ID Not available

Predicted Structure DCTPep01844

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity Not available

Linear/Cyclic Cyclic

Disulfide/Other Bond Cys5<--->Cys19; Cys9<--->Cys21; Cys14<--->Cys26

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Chiral L

Physicochemical Information

Formula C138H223N35O42S6

Absent amino acids FHMNQR

Theoretical pI 7.76

Acidic residues 2

Basic residues 3

Polar residues 15

Molecular weight (Average) 3236.86

Molecular weight (Monoisotopic) 3234.47

Common amino acids C

Net charge 1

Instability index (II) 34.13

Aliphatic index 78.39

Grand average of hydropathicity (GRAVY) 0.555

Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).

Extinction coefficients
Ext. coefficient 7365
Abs 0.1% (=1 g/l) 2.275, assuming all pairs of Cys residues form cystines
Ext. coefficient 6990
Abs 0.1% (=1 g/l) 2.160, assuming all Cys residues are reduced

Amino acid distribution

Literature Information

Literature 1

Pubmed ID 20580652

Title Isolation and characterization of cytotoxic cyclotides from Viola tricolor

Doi 10.1016/j.peptides.2010.05.004

Year 2010

Patent

Patent ID Not available

Patent Title Not available

Other Iinformation Not available

Other Published ID Not available