vitri A
General Information
DCTPep ID DCTPep01845
Peptide Name vitri A
Sequence GIPCGESCVWIPCITSAIGCSCKSKVCYRN
Sequence Length 30
UniProt ID Not available
PubChem CID Not available
Origin Viola tricolor
Type Native peptide
Classification
ACP Tumor active peptide Membrane-targeted
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| BEL-7402 | Human papillomavirus-related endocervical adenocarcinoma | IC50=4.94 µg/ml | SRB assay | 48 h | 1 |
Hemolytic Activity HRBCs: HC50=8.91 Μm
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep01845
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Cys4<--->Cys20; Cys8<--->Cys22; Cys13<--->Cys27; NCB: Gly1<--->Asn30
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C134H217N37O40S6
Absent amino acids DFHLMQ
Theoretical pI 8.33
Acidic residues 1
Basic residues 3
Polar residues 16
Molecular weight (Average) 3178.78
Molecular weight (Monoisotopic) 3176.44
Common amino acids C
Net charge 2
Instability index (II) 18.66
Aliphatic index 74.67
Grand average of hydropathicity (GRAVY) 0.447
Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 7365
Abs 0.1% (=1 g/l) 2.317, assuming all pairs of Cys residues form cystines
Ext. coefficient 6990
Abs 0.1% (=1 g/l) 2.199, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 20580652
Title Isolation and characterization of cytotoxic cyclotides from Viola tricolor
Doi 10.1016/j.peptides.2010.05.004
Year 2010
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available