FGR (7-22)-HEXIM1 (147-164), FGF-BR

General Information


DCTPep ID  DCTPep01937

Peptide Name   FGR (7-22)-HEXIM1 (147-164), FGF-BR

Sequence  AAVALLPAVLLALLAPQLGKKKHRRRPSKKKRHW

Sequence Length  34

UniProt ID  P08620  O94992 

PubChem CID  Not available

Origin  Synthetic

Type  Synthetic peptide

Classification

  

ACP Tumor active peptide



Activity Information


Cell Line Disease Activity Assay Testing Time Literature
HCT 116-/-p53 Colon carcinoma 30%Killing=10 µM CellTox cytotoxicity assay 30 min 1

Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  HEK293: 30%Killing=10 µM; HFF: 20%Killing=10 µM; 90%Killing=50 µM

Target  Not available

Affinity  Not available

Mechanism  Not available



Structure Information


PDB ID  Not available

Predicted Structure  DCTPep01937

(Please note that there is the predicted structure, predicted by AlphaFold)

Parsing response... [0/0]
SequenceNo structure available

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C178H308N58O37

Absent amino acids  CDEFIMNTY

Theoretical pI  12.49

Acidic residues  0

Basic residues  12

Polar residues  2

Molecular weight (Average)  3852.77

Molecular weight (Monoisotopic)  3850.4

Common amino acids  L

Net charge  12

Instability index (II)  89.3

Aliphatic index  115.00

Grand average of hydropathicity (GRAVY)  -0.365

Half Life 
  4.4 hours (mammalian reticulocytes, in vitro).
  >20 hours (yeast, in vivo).
  >10 hours (Escherichia coli, in vivo).

Extinction coefficients 
  Ext. coefficient 5500
  Abs 0.1% (=1 g/l) 1.428

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 26734838

Title  Use of a novel cytotoxic HEXIM1 peptide in the directed breast cancer therapy

Doi 10.18632/oncotarget.6794

Year  2016

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DBAASP ID  DBAASPS_12679

DCTPep is developed by Dr.Zheng's team.