This work is licensed under a Creative Commons Attribution 4.0 International License.
FGR (7-22)-HEXIM1 (147-164), FGF-BR
General Information
DCTPep ID DCTPep01937
Peptide Name FGR (7-22)-HEXIM1 (147-164), FGF-BR
Sequence AAVALLPAVLLALLAPQLGKKKHRRRPSKKKRHW
Sequence Length 34
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
ACP Tumor active peptide
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| HCT 116-/-p53 | Colon carcinoma | 30%Killing=10 µM | CellTox cytotoxicity assay | 30 min | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity HEK293: 30%Killing=10 µM; HFF: 20%Killing=10 µM; 90%Killing=50 µM
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep01937
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C178H308N58O37
Absent amino acids CDEFIMNTY
Theoretical pI 12.49
Acidic residues 0
Basic residues 12
Polar residues 2
Molecular weight (Average) 3852.77
Molecular weight (Monoisotopic) 3850.4
Common amino acids L
Net charge 12
Instability index (II) 89.3
Aliphatic index 115.00
Grand average of hydropathicity (GRAVY) -0.365
Half Life
4.4 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 5500
Abs 0.1% (=1 g/l) 1.428
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 26734838
Title Use of a novel cytotoxic HEXIM1 peptide in the directed breast cancer therapy
Year 2016
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID DBAASPS_12679
This work is licensed under a Creative Commons Attribution 4.0 International License.