This work is licensed under a Creative Commons Attribution 4.0 International License.
PvD1, Defensin D1
General Information
DCTPep ID DCTPep02324
Peptide Name PvD1, Defensin D1
Sequence KTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC
Sequence Length 47
PubChem CID Not available
Origin Phaseolus vulgaris
Type Native peptide
Classification
ACP Tumor active peptide Induce apoptosis
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| MDA-MB-231 | Breast adenocarcinoma | IC50=0.82±0.14 µM | MTT assay | 24 h | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity MCF-10a: 50% Cell death=7 µM
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep02324
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Cys3<--->Cys47; Cys14<--->Cys35; Cys20<--->Cys41; Cys24<--->Cys43
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C222H346N72O73S8
Absent amino acids IMQV
Theoretical pI 8.20
Acidic residues 7
Basic residues 11
Polar residues 22
Molecular weight (Average) 5448.11
Molecular weight (Monoisotopic) 5444.33
Common amino acids C
Net charge 4
Instability index (II) 37.24
Aliphatic index 18.72
Grand average of hydropathicity (GRAVY) -1.149
Half Life
1.3 hours (mammalian reticulocytes, in vitro).
3 min (yeast, in vivo).
3 min (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 7490
Abs 0.1% (=1 g/l) 1.375, assuming all pairs of Cys residues form cystines
Ext. coefficient 6990
Abs 0.1% (=1 g/l) 1.283, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 29076508
Title Challenging metastatic breast cancer with the natural defensin PvD1
Year 2017
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID DBAASPR_4120
This work is licensed under a Creative Commons Attribution 4.0 International License.