This work is licensed under a Creative Commons Attribution 4.0 International License.
Cliotides T7, CT7
General Information
DCTPep ID DCTPep02341
Peptide Name Cliotides T7, CT7
Sequence GIPCGESCVFIPCTVTALLGCSCKDKVCYKN
Sequence Length 31
PubChem CID Not available
Origin Clitoria ternatea
Type Native peptide
Classification
ACP Tumor active peptide
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| A549 | Lung adenocarcinoma | IC50=0.73 µM | MTT assay | 72 h | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep02341
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Cys4<--->Cys21; Cys8<--->Cys23; Cys13<--->Cys28; NCB: Gly1<--->Asn31
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C139H227N35O42S6
Absent amino acids HMQRW
Theoretical pI 7.76
Acidic residues 2
Basic residues 3
Polar residues 15
Molecular weight (Average) 3252.9
Molecular weight (Monoisotopic) 3250.5
Common amino acids C
Net charge 1
Instability index (II) 24.9
Aliphatic index 81.61
Grand average of hydropathicity (GRAVY) 0.577
Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 1865
Abs 0.1% (=1 g/l) 0.573, assuming all pairs of Cys residues form cystines
Ext. coefficient 1490
Abs 0.1% (=1 g/l) 0.458, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 23419988
Title Chemosensitizing activities of cyclotides from Clitoria ternatea in paclitaxel-resistant lung cancer cells
Year 2013
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID DBAASPR_4279
This work is licensed under a Creative Commons Attribution 4.0 International License.