Cliotides T10, CT10

General Information


DCTPep ID  DCTPep02342

Peptide Name   Cliotides T10, CT10

Sequence  GVPCAESCVWIPCTVTALLGCSCKDKVCYLN

Sequence Length  31

UniProt ID  P86842 

PubChem CID  Not available

Origin  Clitoria ternatea

Type  Native peptide

Classification

  

ACP Tumor active peptide



Activity Information


Cell Line Disease Activity Assay Testing Time Literature
A549 Lung adenocarcinoma IC50=0.7 µM MTT assay 72 h 1

Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available



Structure Information


PDB ID  Not available

Predicted Structure  DCTPep02342

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity  Not available

Linear/Cyclic  Cyclic

Disulfide/Other Bond  Cys4<--->Cys21; Cys8<--->Cys23; Cys13<--->Cys28; NCB: Gly1<--->Asn31

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C141H227N35O42S6

Absent amino acids  FHMQR

Theoretical pI  6.03

Acidic residues  2

Basic residues  2

Polar residues  14

Molecular weight (Average)  3276.92

Molecular weight (Monoisotopic)  3274.5

Common amino acids  C

Net charge  0

Instability index (II)  37.21

Aliphatic index  94.19

Grand average of hydropathicity (GRAVY)  0.768

Half Life 
  30 hours (mammalian reticulocytes, in vitro).
  >20 hours (yeast, in vivo).
  >10 hours (Escherichia coli, in vivo).

Extinction coefficients 
  Ext. coefficient 7365
  Abs 0.1% (=1 g/l) 2.248, assuming all pairs of Cys residues form cystines
  Ext. coefficient 6990
  Abs 0.1% (=1 g/l) 2.133, assuming all Cys residues are reduced

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 23419988

Title  Chemosensitizing activities of cyclotides from Clitoria ternatea in paclitaxel-resistant lung cancer cells

Doi 10.3892/ol.2012.1042

Year  2013

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DBAASP ID  DBAASPR_4280

DCTPep is developed by Dr.Zheng's team.