This work is licensed under a Creative Commons Attribution 4.0 International License.
SPP-12
General Information
DCTPep ID DCTPep02347
Peptide Name SPP-12
Sequence GSHGAFCHLCEDLIKDGKEAGDVALDVWLDEEIGSRCKDFGVLASECFKELKVAEHDIWEAIDQEIPEDKTCKEAKLC
Sequence Length 78
UniProt ID Q9XVI5
PubChem CID Not available
Origin Caenorhabditis elegans
Type Native peptide
Classification
ACP Tumor active peptide
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| Jurkat | Childhood T acute lymphoblastic leukemia; Precursor T-cell acute lymphoblastic leukemia | Low active up to 10 µM | Fluorescent dye SYTOX Green assay | Not available | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep02347
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Cys7<--->Cys78; Cys10<--->Cys72; Cys37<--->Cys47
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C378H588N98O124S6
Absent amino acids MNY
Theoretical pI 4.46
Acidic residues 20
Basic residues 12
Polar residues 16
Molecular weight (Average) 8681.77
Molecular weight (Monoisotopic) 8676.1
Common amino acids E
Net charge -8
Instability index (II) 31.78
Aliphatic index 83.85
Grand average of hydropathicity (GRAVY) -0.331
Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 11375
Abs 0.1% (=1 g/l) 1.310, assuming all pairs of Cys residues form cystines
Ext. coefficient 11000
Abs 0.1% (=1 g/l) 1.267, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 22519640
Title The saposin-like protein SPP-12 is an antimicrobial polypeptide in the pharyngeal neurons of Caenorhabditis elegans and participates in defence against a natural bacterial pathogen
Year 2012
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID DBAASPS_4296
This work is licensed under a Creative Commons Attribution 4.0 International License.