SPP-12

General Information


DCTPep ID  DCTPep02347

Peptide Name   SPP-12

Sequence  GSHGAFCHLCEDLIKDGKEAGDVALDVWLDEEIGSRCKDFGVLASECFKELKVAEHDIWEAIDQEIPEDKTCKEAKLC

Sequence Length  78

UniProt ID  Q9XVI5 

PubChem CID  Not available

Origin  Caenorhabditis elegans

Type  Native peptide

Classification

  

ACP Tumor active peptide



Activity Information


Cell Line Disease Activity Assay Testing Time Literature
Jurkat Childhood T acute lymphoblastic leukemia; Precursor T-cell acute lymphoblastic leukemia Low active up to 10 µM Fluorescent dye SYTOX Green assay Not available 1

Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available



Structure Information


PDB ID  Not available

Predicted Structure  DCTPep02347

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity  Not available

Linear/Cyclic  Cyclic

Disulfide/Other Bond  Cys7<--->Cys78; Cys10<--->Cys72; Cys37<--->Cys47

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C378H588N98O124S6

Absent amino acids  MNY

Theoretical pI  4.46

Acidic residues  20

Basic residues  12

Polar residues  16

Molecular weight (Average)  8681.77

Molecular weight (Monoisotopic)  8676.1

Common amino acids  E

Net charge  -8

Instability index (II)  31.78

Aliphatic index  83.85

Grand average of hydropathicity (GRAVY)  -0.331

Half Life 
  30 hours (mammalian reticulocytes, in vitro).
  >20 hours (yeast, in vivo).
  >10 hours (Escherichia coli, in vivo).

Extinction coefficients 
  Ext. coefficient 11375
  Abs 0.1% (=1 g/l) 1.310, assuming all pairs of Cys residues form cystines
  Ext. coefficient 11000
  Abs 0.1% (=1 g/l) 1.267, assuming all Cys residues are reduced

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 22519640

Title  The saposin-like protein SPP-12 is an antimicrobial polypeptide in the pharyngeal neurons of Caenorhabditis elegans and participates in defence against a natural bacterial pathogen

Doi 10.1042/BJ20112102

Year  2012

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DBAASP ID  DBAASPS_4296

DCTPep is developed by Dr.Zheng's team.