Crotamine
General Information
DCTPep ID DCTPep02361
Peptide Name Crotamine
Sequence YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG
Sequence Length 42
UniProt ID Q9PWF3
PubChem CID Not available
Origin Crotalus durissus terrificus
Type Native peptide
Classification
ACP Tumor active peptide Cell-penetrating peptides
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| CHO-K1 | Ovary tumor | IC50=5 µM | MTT assay | 24 h | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity HEK293: 50% Cell death>50 µM; BMDMs: 3% Cell death=50 µg/ml
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep02361
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Cys4<--->Cys36; Cys11<--->Cys30; Cys18<--->Cys37
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C214H332N64O54S7
Absent amino acids ANTV
Theoretical pI 9.51
Acidic residues 3
Basic residues 13
Polar residues 15
Molecular weight (Average) 4889.81
Molecular weight (Monoisotopic) 4886.32
Common amino acids K
Net charge 10
Instability index (II) 82.61
Aliphatic index 18.57
Grand average of hydropathicity (GRAVY) -1.095
Half Life
2.8 hours (mammalian reticulocytes, in vitro).
10 min (yeast, in vivo).
2 min (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 12865
Abs 0.1% (=1 g/l) 2.631, assuming all pairs of Cys residues form cystines
Ext. coefficient 12490
Abs 0.1% (=1 g/l) 2.554, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 18662711
Title Cytotoxic effects of crotamine are mediated through lysosomal membrane permeabilization
Doi 10.1016/j.toxicon.2008.06.029
Year 2008
Literature 2
Pubmed ID 23022146
Title Unraveling the antifungal activity of a South American rattlesnake toxin crotamine
Doi Unraveling the antifungal activity of a South American rattlesnake toxin crotamine
Year 2013
Literature 3
Pubmed ID 31994997
Title Effect of Isolated Proteins from Crotalus Durissus Terrificus Venom on Leishmania (Leishmania) Amazonensis-Infected Macrophages
Doi 10.2174/0929866527666200129152954
Year 2020
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID DBAASPR_4321