Peptide Libraray

Psalmopeotoxin I, PcFK1

General Information

DCTPep ID DCTPep02373

Peptide Name Psalmopeotoxin I, PcFK1

Sequence ACGILHDNCVYVPAQNPCCRGLQCRYGKCLVQV

Sequence Length 33

UniProt ID P0C201

PubChem CID Not available

Origin Psalmopoeus cambridgei

Type Native peptide

Classification

Cancer therapy related peptides

Activity Information

Cell Line	Disease	Activity	Assay	Testing Time	Literature
HeLa 229	Human papillomavirus-related endocervical adenocarcinoma	Not active up to 50 µM	PI and Annexin-V-FITC double-staining	48 h	1

Hemolytic Activity Human erythrocytes: Not active at 10 µM

Normal (non-cancerous) Cytotoxicity Not available

Target Not available

Affinity Not available

Mechanism Not available

Structure Information

PDB ID Not available

Predicted Structure DCTPep02373

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity Not available

Linear/Cyclic Cyclic

Disulfide/Other Bond Cys2<--->Cys19; Cys9<--->Cys24; Cys18<--->Cys29

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Chiral L

Physicochemical Information

Formula C153H247N47O43S6

Absent amino acids EFMSTW

Theoretical pI 8.35

Acidic residues 1

Basic residues 4

Polar residues 13

Molecular weight (Average) 3625.29

Molecular weight (Monoisotopic) 3622.69

Common amino acids C

Net charge 3

Instability index (II) 30.49

Aliphatic index 88.48

Grand average of hydropathicity (GRAVY) 0.218

Half Life
4.4 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).

Extinction coefficients
Ext. coefficient 3355
Abs 0.1% (=1 g/l) 0.925, assuming all pairs of Cys residues form cystines
Ext. coefficient 2980
Abs 0.1% (=1 g/l) 0.822, assuming all Cys residues are reduced

Amino acid distribution

Literature Information

Literature 1

Pubmed ID 15304333

Title Isolation and characterization of Psalmopeotoxin I and II: two novel antimalarial peptides from the venom of the tarantula Psalmopoeus cambridgei

Doi 10.1016/j.febslet.2004.07.019

Year 2004

Patent

Patent ID Not available

Patent Title Not available

Other Iinformation Not available

Other Published ID Not available

External Code

DBAASP ID DBAASPR_4467