Psalmopeotoxin I, PcFK1
General Information
DCTPep ID DCTPep02373
Peptide Name Psalmopeotoxin I, PcFK1
Sequence ACGILHDNCVYVPAQNPCCRGLQCRYGKCLVQV
Sequence Length 33
UniProt ID P0C201
PubChem CID Not available
Origin Psalmopoeus cambridgei
Type Native peptide
Classification
Cancer therapy related peptides
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| HeLa 229 | Human papillomavirus-related endocervical adenocarcinoma | Not active up to 50 µM | PI and Annexin-V-FITC double-staining | 48 h | 1 |
Hemolytic Activity Human erythrocytes: Not active at 10 µM
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep02373
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Cys2<--->Cys19; Cys9<--->Cys24; Cys18<--->Cys29
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C153H247N47O43S6
Absent amino acids EFMSTW
Theoretical pI 8.35
Acidic residues 1
Basic residues 4
Polar residues 13
Molecular weight (Average) 3625.29
Molecular weight (Monoisotopic) 3622.69
Common amino acids C
Net charge 3
Instability index (II) 30.49
Aliphatic index 88.48
Grand average of hydropathicity (GRAVY) 0.218
Half Life
4.4 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 3355
Abs 0.1% (=1 g/l) 0.925, assuming all pairs of Cys residues form cystines
Ext. coefficient 2980
Abs 0.1% (=1 g/l) 0.822, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 15304333
Title Isolation and characterization of Psalmopeotoxin I and II: two novel antimalarial peptides from the venom of the tarantula Psalmopoeus cambridgei
Doi 10.1016/j.febslet.2004.07.019
Year 2004
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID DBAASPR_4467