HR2PM2
General Information
DCTPep ID DCTPep02753
Peptide Name HR2PM2
Sequence SLTQINTTLLDLEYEMKKLEEVVKKLEESYIDLKEL
Sequence Length 36
UniProt ID K9N5Q8
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Lipopeptides
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| Huh-7 | Adult hepatocellular carcinoma; Adult hepatocellular carcinoma | CC50>100 µM | CCK-8 assay | 48 h | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep02753
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C193H321N43O64S1
Absent amino acids ACFGHPRW
Theoretical pI 4.48
Acidic residues 9
Basic residues 5
Polar residues 8
Molecular weight (Average) 4299.98
Molecular weight (Monoisotopic) 4297.29
Common amino acids L
Net charge -4
Instability index (II) 18.76
Aliphatic index 124.44
Grand average of hydropathicity (GRAVY) -0.406
Half Life
1.9 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 2980
Abs 0.1% (=1 g/l) 0.693
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 30192544
Title De Novo Design of α-Helical Lipopeptides Targeting Viral Fusion Proteins: A Promising Strategy for Relatively Broad-Spectrum Antiviral Drug Discovery
Doi 10.1021/acs.jmedchem.8b00890
Year 2018
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID DBAASPS_15196