This work is licensed under a Creative Commons Attribution 4.0 International License.
Cathelicidin-like peptide, Crotalicidin
General Information
DCTPep ID DCTPep03491
Peptide Name Cathelicidin-like peptide, Crotalicidin
Sequence KRFKKFFKKVKKSVKKRLKKIFKKPMVIGVTIPF
Sequence Length 34
PubChem CID Not available
Origin Synthetic
Type Native peptide
Classification
Cancer therapy related peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID 2MWT
Predicted Structure DCTPep03491
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Amidation
Other Modification None
Chiral L
Physicochemical Information
Formula C203H345N53O37S1
Absent amino acids ACDEHNQWY
Theoretical pI 12.09
Acidic residues 0
Basic residues 15
Polar residues 3
Molecular weight (Average) 4152.37
Molecular weight (Monoisotopic) 4149.65
Common amino acids K
Net charge 15
Instability index (II) 4.32
Aliphatic index 80.00
Grand average of hydropathicity (GRAVY) -0.435
Half Life
1.3 hours (mammalian reticulocytes, in vitro).
3 min (yeast, in vivo).
3 min (Escherichia coli, in vivo).
Extinction coefficients
Should not be visible by UV spectrophotometry.
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 29208061
Title Antichagasic effect of crotalicidin, a cathelicidin-like vipericidin, found in Crotalus durissus terrificus rattlesnake's venom gland
Doi Not available
Year 2017
Literature 2
Pubmed ID 27876749
Title Anti-fungal activity of Ctn[15-34], the C-terminal peptide fragment of crotalicidin, a rattlesnake venom gland cathelicidin
Doi Not available
Year 2016
Literature 3
Pubmed ID 26465972
Title Structural Dissection of Crotalicidin, a Rattlesnake Venom Cathelicidin, Retrieves a Fragment with Antimicrobial and Antitumor Activity
Doi Not available
Year 2015
Literature 4
Pubmed ID 25100358
Title Vipericidins: a novel family of cathelicidin-related peptides from the venom gland of South American pit vipers
Doi Not available
Year 2014
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 5383
This work is licensed under a Creative Commons Attribution 4.0 International License.