Carnobacteriocin BM1

General Information


DCTPep ID  DCTPep03522

Peptide Name   Carnobacteriocin BM1

Sequence  AISYGNGVYCNKEKCWVNKAENKQAITGIVIGGWASSLAGMGH

Sequence Length  43

UniProt ID  P38579 

PubChem CID  Not available

Origin  Bacteria

Type  Native peptide

Classification

  

Cancer therapy related peptides



Activity Information


Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available



Structure Information


PDB ID  Not available

Predicted Structure  DCTPep03522

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C199H310N56O59S3

Absent amino acids  DFPR

Theoretical pI  8.76

Acidic residues  2

Basic residues  5

Polar residues  19

Molecular weight (Average)  4527.17

Molecular weight (Monoisotopic)  4524.21

Common amino acids  G

Net charge  3

Instability index (II)  26.93

Aliphatic index  77.21

Grand average of hydropathicity (GRAVY)  -0.077

Half Life 
  4.4 hours (mammalian reticulocytes, in vitro).
  >20 hours (yeast, in vivo).
  >10 hours (Escherichia coli, in vivo).

Extinction coefficients 
  Ext. coefficient 14105
  Abs 0.1% (=1 g/l) 3.116, assuming all pairs of Cys residues form cystines
  Ext. coefficient 13980
  Abs 0.1% (=1 g/l) 3.088, assuming all Cys residues are reduced

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 19271288

Title  Interactions between two carnobacteriocins Cbn BM1 and Cbn B2 from Carnobacterium maltaromaticum CP5 on target bacteria and Caco-2 cells

Doi Not available

Year  2009

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DBAASP ID  6216

DCTPep is developed by Dr.Zheng's team.