This work is licensed under a Creative Commons Attribution 4.0 International License.
Carnobacteriocin B2
General Information
DCTPep ID DCTPep03523
Peptide Name Carnobacteriocin B2
Sequence VNYGNGVSCSKTKCSVNWGQAFQERYTAGINSFVSGVASGAGSIGRRP
Sequence Length 48
UniProt ID P38580
PubChem CID Not available
Origin Bacteria
Type Native peptide
Classification
Cancer therapy related peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID 1CW5
Predicted Structure DCTPep03523
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C213H332N66O68S2
Absent amino acids DHLM
Theoretical pI 9.70
Acidic residues 1
Basic residues 5
Polar residues 25
Molecular weight (Average) 4969.5
Molecular weight (Monoisotopic) 4966.4
Common amino acids G
Net charge 4
Instability index (II) 18.68
Aliphatic index 54.79
Grand average of hydropathicity (GRAVY) -0.277
Half Life
100 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 8605
Abs 0.1% (=1 g/l) 1.732, assuming all pairs of Cys residues form cystines
Ext. coefficient 8480
Abs 0.1% (=1 g/l) 1.706, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 19271288
Title Interactions between two carnobacteriocins Cbn BM1 and Cbn B2 from Carnobacterium maltaromaticum CP5 on target bacteria and Caco-2 cells
Doi Not available
Year 2009
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 6227
This work is licensed under a Creative Commons Attribution 4.0 International License.