Peptide Libraray

Recombinant Pro-Omhep1, Recombinant Hepcidin

General Information

DCTPep ID DCTPep03528

Peptide Name Recombinant Pro-Omhep1, Recombinant Hepcidin

Sequence MGSSHHHHHHSSGLVPRGSHMIPVNGVTELEEAASNDTPVAARHEMSMQSWMMPNHIREKRQSHLSMCSVCCNCCKNYKGCGFCCRF

Sequence Length 87

UniProt ID G4VXJ6

PubChem CID Not available

Origin Synthetic

Type Synthetic peptide

Classification

Cancer therapy related peptides

Activity Information

Hemolytic Activity Not available

Normal (non-cancerous) Cytotoxicity Not available

Target Not available

Affinity Not available

Mechanism Not available

Structure Information

PDB ID Not available

Predicted Structure DCTPep03528

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity Not available

Linear/Cyclic Linear

Disulfide/Other Bond Not available

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Chiral L

Physicochemical Information

Formula C404H629N133O121S15

Absent amino acids Not Applicable

Theoretical pI 8.19

Acidic residues 6

Basic residues 18

Polar residues 33

Molecular weight (Average) 9766.16

Molecular weight (Monoisotopic) 9759.3

Common amino acids SH

Net charge 12

Instability index (II) 53.96

Aliphatic index 43.68

Grand average of hydropathicity (GRAVY) -0.522

Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).

Extinction coefficients
Ext. coefficient 7490
Abs 0.1% (=1 g/l) 0.767, assuming all pairs of Cys residues form cystines
Ext. coefficient 6990
Abs 0.1% (=1 g/l) 0.716, assuming all Cys residues are reduced

Amino acid distribution

Literature Information

Literature 1

Pubmed ID 22051539

Title Recombinant medaka (Oryzias melastigmus) pro-hepcidin: Multifunctional characterization

Doi Not available

Year 2012

Patent

Patent ID Not available

Patent Title Not available

Other Iinformation Not available

Other Published ID Not available

External Code

DBAASP ID 6334