Recombinant Pro-Omhep1, Recombinant Hepcidin

General Information


DCTPep ID  DCTPep03528

Peptide Name   Recombinant Pro-Omhep1, Recombinant Hepcidin

Sequence  MGSSHHHHHHSSGLVPRGSHMIPVNGVTELEEAASNDTPVAARHEMSMQSWMMPNHIREKRQSHLSMCSVCCNCCKNYKGCGFCCRF

Sequence Length  87

UniProt ID  G4VXJ6 

PubChem CID  Not available

Origin  Synthetic

Type  Synthetic peptide

Classification

  

Cancer therapy related peptides



Activity Information


Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available



Structure Information


PDB ID  Not available

Predicted Structure  DCTPep03528

(Please note that there is the predicted structure, predicted by AlphaFold)

SequenceNo structure available

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C404H629N133O121S15

Absent amino acids  Not Applicable

Theoretical pI  8.19

Acidic residues  6

Basic residues  18

Polar residues  33

Molecular weight (Average)  9766.16

Molecular weight (Monoisotopic)  9759.3

Common amino acids  SH

Net charge  12

Instability index (II)  53.96

Aliphatic index  43.68

Grand average of hydropathicity (GRAVY)  -0.522

Half Life 
  30 hours (mammalian reticulocytes, in vitro).
  >20 hours (yeast, in vivo).
  >10 hours (Escherichia coli, in vivo).

Extinction coefficients 
  Ext. coefficient 7490
  Abs 0.1% (=1 g/l) 0.767, assuming all pairs of Cys residues form cystines
  Ext. coefficient 6990
  Abs 0.1% (=1 g/l) 0.716, assuming all Cys residues are reduced

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 22051539

Title  Recombinant medaka (Oryzias melastigmus) pro-hepcidin: Multifunctional characterization

Doi Not available

Year  2012

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DBAASP ID  6334

DCTPep is developed by Dr.Zheng's team.