Eosinophil cationic protein (1-45) [C23,37S], RNase 3 (1-45) [C23,37S]

General Information


DCTPep ID  DCTPep03529

Peptide Name   Eosinophil cationic protein (1-45) [C23,37S], RNase 3 (1-45) [C23,37S]

Sequence  RPPQFTRAQWFAIQHISLNPPRSTIAMRAINNYRWRSKNQNTFLR

Sequence Length  45

UniProt ID  P12724 

PubChem CID  Not available

Origin  Synthetic

Type  Synthetic peptide

Classification

  

Cancer therapy related peptides



Activity Information


Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available



Structure Information


PDB ID  Not available

Predicted Structure  DCTPep03529

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C246H382N80O62S1

Absent amino acids  CDEGV

Theoretical pI  12.40

Acidic residues  0

Basic residues  9

Polar residues  12

Molecular weight (Average)  5484.3

Molecular weight (Monoisotopic)  5480.89

Common amino acids  R

Net charge  9

Instability index (II)  62.96

Aliphatic index  60.89

Grand average of hydropathicity (GRAVY)  -0.911

Half Life 
  1 hours (mammalian reticulocytes, in vitro).
  2 min (yeast, in vivo).
  2 min (Escherichia coli, in vivo).

Extinction coefficients 
  Ext. coefficient 12490
  Abs 0.1% (=1 g/l) 2.277

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 31540052

Title  Insight into the Antifungal Mechanism of Action of Human RNase N-terminus Derived Peptides

Doi Not available

Year  2019

Literature 2

Pubmed ID 23716047

Title  Two human host defense ribonucleases against mycobacteria, the eosinophil cationic protein (RNase 3) and RNase 7

Doi Not available

Year  2013

Literature 3

Pubmed ID 21696142

Title  Refining the eosinophil cationic protein antibacterial pharmacophore by rational structure minimization

Doi Not available

Year  2011

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DBAASP ID  6543

DCTPep is developed by Dr.Zheng's team.