DCTPep ID  DCTPep03543

Peptide Name   Ribonuclease 7 (1-45) [C23,37S]

Sequence  KPKGMTSSQWFKIQHMQPSPQASNSAMKNINKHTKRSKDLNTFLH

Sequence Length  45

UniProt ID  Q9H1E1 

PubChem CID  Not available

Origin  Synthetic

Type  Synthetic peptide

Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available

PDB ID  Not available

Predicted Structure  DCTPep03543

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L

Grand average of hydropathicity (GRAVY)  -1.209

Half Life 
  1.3 hours (mammalian reticulocytes, in vitro).
  3 min (yeast, in vivo).
  3 min (Escherichia coli, in vivo).

Extinction coefficients 
  Ext. coefficient 5500
  Abs 0.1% (=1 g/l) 1.056

Amino acid distribution

Literature 1

Pubmed ID 31540052

Title  Insight into the Antifungal Mechanism of Action of Human RNase N-terminus Derived Peptides

Doi Not available

Year  2019

Literature 2

Pubmed ID 23962023

Title  Ribonucleases as a host-defence family: evidence of evolutionarily conserved antimicrobial activity at the N-terminus

Doi Not available

Year  2013

Literature 3

Pubmed ID 23716047

Title  Two human host defense ribonucleases against mycobacteria, the eosinophil cationic protein (RNase 3) and RNase 7

Doi Not available

Year  2013

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available

DBAASP ID  7120