Ribonuclease pancreatic (1-48)[C26,40S]

General Information


DCTPep ID  DCTPep03561

Peptide Name   Ribonuclease pancreatic (1-48)[C26,40S]

Sequence  KESRAKKFQRQHMDSDSSPSSSSTYSNQMMRRRNMTQGRSKPVNTFVH

Sequence Length  48

UniProt ID  P07998 

PubChem CID  Not available

Origin  Synthetic

Type  Synthetic peptide

Classification

  

Cancer therapy related peptides



Activity Information


Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available



Structure Information


PDB ID  Not available

Predicted Structure  DCTPep03561

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C231H377N81O76S4

Absent amino acids  CILW

Theoretical pI  11.40

Acidic residues  3

Basic residues  12

Polar residues  18

Molecular weight (Average)  5633.27

Molecular weight (Monoisotopic)  5629.7

Common amino acids  S

Net charge  9

Instability index (II)  91.99

Aliphatic index  14.17

Grand average of hydropathicity (GRAVY)  -1.575

Half Life 
  1.3 hours (mammalian reticulocytes, in vitro).
  3 min (yeast, in vivo).
  3 min (Escherichia coli, in vivo).

Extinction coefficients 
  Ext. coefficient 1490
  Abs 0.1% (=1 g/l) 0.265

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 31540052

Title  Insight into the Antifungal Mechanism of Action of Human RNase N-terminus Derived Peptides

Doi Not available

Year  2019

Literature 2

Pubmed ID 23962023

Title  Ribonucleases as a host-defence family: evidence of evolutionarily conserved antimicrobial activity at the N-terminus

Doi Not available

Year  2013

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DBAASP ID  7639

DCTPep is developed by Dr.Zheng's team.