This work is licensed under a Creative Commons Attribution 4.0 International License.
Angiogenin (1-47)[C26,39S], Ribonuclease A A1 (1-47)[C26,39S]
General Information
DCTPep ID DCTPep03564
Peptide Name Angiogenin (1-47)[C26,39S], Ribonuclease A A1 (1-47)[C26,39S]
Sequence QDNSRYTHFLTQHYDAKPQGRDDRYSESIMRRRGLTSPSKDINTFIH
Sequence Length 47
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Cancer therapy related peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep03564
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C242H374N78O77S1
Absent amino acids CVW
Theoretical pI 9.40
Acidic residues 6
Basic residues 11
Polar residues 16
Molecular weight (Average) 5640.17
Molecular weight (Monoisotopic) 5636.75
Common amino acids R
Net charge 5
Instability index (II) 70.49
Aliphatic index 43.62
Grand average of hydropathicity (GRAVY) -1.430
Half Life
0.8 hours (mammalian reticulocytes, in vitro).
10 min (yeast, in vivo).
10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 4470
Abs 0.1% (=1 g/l) 0.793
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 31540052
Title Insight into the Antifungal Mechanism of Action of Human RNase N-terminus Derived Peptides
Doi Not available
Year 2019
Literature 2
Pubmed ID 23962023
Title Ribonucleases as a host-defence family: evidence of evolutionarily conserved antimicrobial activity at the N-terminus
Doi Not available
Year 2013
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 7643
This work is licensed under a Creative Commons Attribution 4.0 International License.