Peptide Libraray

Ribonuclease 8 (1-45)[C23,37S]

General Information

DCTPep ID DCTPep03566

Peptide Name Ribonuclease 8 (1-45)[C23,37S]

Sequence KPKDMTSSQWFKTQHVQPSPQASNSAMSIINKYTERSKDLNTFLH

Sequence Length 45

UniProt ID Q8TDE3

PubChem CID Not available

Origin Synthetic

Type Synthetic peptide

Classification

Cancer therapy related peptides

Activity Information

Hemolytic Activity Not available

Normal (non-cancerous) Cytotoxicity Not available

Target Not available

Affinity Not available

Mechanism Not available

Structure Information

PDB ID Not available

Predicted Structure DCTPep03566

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity Not available

Linear/Cyclic Linear

Disulfide/Other Bond Not available

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Chiral L

Physicochemical Information

Formula C228H357N65O71S2

Absent amino acids CG

Theoretical pI 9.70

Acidic residues 3

Basic residues 8

Polar residues 15

Molecular weight (Average) 5208.86

Molecular weight (Monoisotopic) 5205.58

Common amino acids S

Net charge 5

Instability index (II) 61.65

Aliphatic index 45.56

Grand average of hydropathicity (GRAVY) -1.044

Half Life
1.3 hours (mammalian reticulocytes, in vitro).
3 min (yeast, in vivo).
3 min (Escherichia coli, in vivo).

Extinction coefficients
Ext. coefficient 6990
Abs 0.1% (=1 g/l) 1.342

Amino acid distribution

Literature Information

Literature 1

Pubmed ID 31540052

Title Insight into the Antifungal Mechanism of Action of Human RNase N-terminus Derived Peptides

Doi Not available

Year 2019

Literature 2

Pubmed ID 23962023

Title Ribonucleases as a host-defence family: evidence of evolutionarily conserved antimicrobial activity at the N-terminus

Doi Not available

Year 2013

Patent

Patent ID Not available

Patent Title Not available

Other Iinformation Not available

Other Published ID Not available

External Code

DBAASP ID 7645