This work is licensed under a Creative Commons Attribution 4.0 International License.
Cecropin B (1-24)+(1-10)
General Information
DCTPep ID DCTPep03584
Peptide Name Cecropin B (1-24)+(1-10)
Sequence KWKVFKKIEKMGRNIRNGIVKAGPKWKVFKKIEK
Sequence Length 34
UniProt ID P01508
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Cancer therapy related peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep03584
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Amidation
Other Modification None
Chiral L
Physicochemical Information
Formula C194H323N55O41S1
Absent amino acids CDHLQSTY
Theoretical pI 10.93
Acidic residues 2
Basic residues 13
Polar residues 5
Molecular weight (Average) 4114.1
Molecular weight (Monoisotopic) 4111.46
Common amino acids K
Net charge 11
Instability index (II) 36.23
Aliphatic index 74.41
Grand average of hydropathicity (GRAVY) -0.900
Half Life
1.3 hours (mammalian reticulocytes, in vitro).
3 min (yeast, in vivo).
3 min (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 11000
Abs 0.1% (=1 g/l) 2.674
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 11004545
Title Conformational study of a custom antibacterial peptide cecropin B1: implications of the lytic activity
Doi Not available
Year 2000
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 7842
This work is licensed under a Creative Commons Attribution 4.0 International License.