Palustrin-2CE
General Information
DCTPep ID DCTPep03593
Peptide Name Palustrin-2CE
Sequence GLWDSIKNFGKTIALNVMDKIKCKIGGGCPP
Sequence Length 31
UniProt ID F1AEK6
PubChem CID Not available
Origin Animalia
Type Native peptide
Classification
Cancer therapy related peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C148H243N39O40S3
Absent amino acids EHQRY
Theoretical pI 9.24
Acidic residues 2
Basic residues 5
Polar residues 11
Molecular weight (Average) 3304.97
Molecular weight (Monoisotopic) 3302.73
Common amino acids GK
Net charge 3
Instability index (II) 22.64
Aliphatic index 88.06
Grand average of hydropathicity (GRAVY) 0.006
Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 5625
Abs 0.1% (=1 g/l) 1.702, assuming all pairs of Cys residues form cystines
Ext. coefficient 5500
Abs 0.1% (=1 g/l) 1.664, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 21303203
Title Molecular cloning of novel antimicrobial peptide genes from the skin of the Chinese brown frog, Rana chensinensis
Doi Not available
Year 2011
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 8066