DCTPep ID  DCTPep03647

Peptide Name   Laterosporulin 10

Sequence  ACVNQCPDAIDRFIVKDKGCHGVEKKYYKQVYVACMNGQHLYCRTEWGGPCQL

Sequence Length  53

UniProt ID  Not available

PubChem CID  Not available

Origin  Synthetic

Type  Native peptide

Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available

PDB ID  6LWZ 

Predicted Structure  Not available

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L

Grand average of hydropathicity (GRAVY)  -0.428

Half Life 
  4.4 hours (mammalian reticulocytes, in vitro).
  >20 hours (yeast, in vivo).
  >10 hours (Escherichia coli, in vivo).

Extinction coefficients 
  Ext. coefficient 11835
  Abs 0.1% (=1 g/l) 1.950, assuming all pairs of Cys residues form cystines
  Ext. coefficient 11460
  Abs 0.1% (=1 g/l) 1.889, assuming all Cys residues are reduced

Amino acid distribution

Literature 1

Pubmed ID 28422156

Title  Anticancer properties of a defensin like class IId bacteriocin Laterosporulin10

Doi Not available

Year  2017

Literature 2

Pubmed ID 27267959

Title  Laterosporulin10: a novel defensin like Class IId bacteriocin from Brevibacillus sp strain SKDU10 with inhibitory activity against microbial pathogens

Doi Not available

Year  2016

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available

DBAASP ID  9529